LANCL1 (NM_006055) Human Recombinant Protein

LANCL1 protein,

Product Info Summary

SKU: PROTO43813
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

LANCL1 (NM_006055) Human Recombinant Protein

View all LANCL1 recombinant proteins

SKU/Catalog Number

PROTO43813

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LANCL1 (NM_006055) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO43813)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

45.1 kDa

Amino Acid Sequence

MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL

Validation Images & Assay Conditions

Gene/Protein Information For LANCL1 (Source: Uniprot.org, NCBI)

Gene Name

LANCL1

Full Name

Glutathione S-transferase LANCL1

Weight

45.1 kDa

Superfamily

LanC-like protein family

Alternative Names

40 kDa erythrocyte membrane protein; LanC (bacterial lantibiotic synthetase component C)-like 1; LanC (bacterial lantibiotic synthetase component); LanC lantibiotic synthetase component C-like 1 (bacterial); lanC-like protein 1; p40GPR69AG protein-coupled receptor 69A LANCL1 GPR69A, p40 LanC like 1 glutathione S-transferase LANCL1|40 kDa erythrocyte membrane protein|G protein-coupled receptor 69A|LanC (bacterial lantibiotic synthetase component C)-like 1|LanC (bacterial lantibiotic synthetase component)|LanC lantibiotic synthetase component C-like 1|lanC-like protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LANCL1, check out the LANCL1 Infographic

LANCL1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LANCL1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO43813

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LANCL1 (NM_006055) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LANCL1 (NM_006055) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LANCL1 (NM_006055) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO43813
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.