KLHL17 (NM_198317) Human Recombinant Protein

Klhl17 protein,

Recombinant protein of human kelch-like 17 (Drosophila) (KLHL17)

Product Info Summary

SKU: PROTQ6TDP4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

KLHL17 (NM_198317) Human Recombinant Protein

View all Klhl17 recombinant proteins

SKU/Catalog Number

PROTQ6TDP4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human kelch-like 17 (Drosophila) (KLHL17)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

KLHL17 (NM_198317) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6TDP4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

69.7 kDa

Amino Acid Sequence

MQPRSERPAGRTQSPEHGSPGPGPEAPPPPPPQPPAPEAERTRPRQARPAAPMEGAVQLLSREGHSVAHNSKRHYHDAFVAMSRMRQRGLLCDIVLHVAAKEIRAHKVVLASCSPYFHAMFTNEMSESRQTHVTLHDIDPQALDQLVQFAYTAEIVVGEGNVQTLLPAASLLQLNGVRDACCKFLLSQLDPSNCLGIRGFADAHSCSDLLKAAHRYVLQHFVDVAKTEEFMLLPLKQVLELVSSDSLNVPSEEEVYRAVLSWVKHDVDARRQHVPRLMKCVRLPLLSRDFLLGHVDAESLVRHHPDCKDLLIEALKFHLLPEQRGVLGTSRTRPRRCEGAGPVLFAVGGGSLFAIHGDCEAYDTRTDRWHVVASMSTRRARVGVAAVGNRLYAVGGYDGTSDLATVESYDPVTNTWQPEVSMGTRRSCLGVAALHGLLYSAGGYDGASCLNSAERYDPLTGTWTSVAAMSTRRRYVRVATLDGNLYAVGGYDSSSHLATVEKYEPQVNVWSPVASMLSRRSSAGVAVLEGALYVAGGNDGTSCLNSVERYSPKAGAWESVAPMNIRRSTHDLVAMDGWLYAVGGNDGSSSLNSIEKYNPRTNKWVAASCMFTRRSSVGVAVLELLNFPPPSSPTLSVSSTSL

Validation Images & Assay Conditions

Gene/Protein Information For KLHL17 (Source: Uniprot.org, NCBI)

Gene Name

KLHL17

Full Name

Kelch-like protein 17

Weight

69.7 kDa

Alternative Names

actinfilin; kelch-like 17 (Drosophila); kelch-like protein 17

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on KLHL17, check out the KLHL17 Infographic

KLHL17 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KLHL17: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6TDP4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used KLHL17 (NM_198317) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For KLHL17 (NM_198317) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for KLHL17 (NM_198317) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6TDP4
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.