KGF (FGF7) (NM_002009) Human Recombinant Protein

KGF/FGF-7 protein,

Product Info Summary

SKU: PROTP21781
Size: 20 µg
Source: HEK293T

Product Name

KGF (FGF7) (NM_002009) Human Recombinant Protein

View all KGF/FGF-7 recombinant proteins

SKU/Catalog Number

PROTP21781

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human fibroblast growth factor 7 (keratinocyte growth factor) (FGF7)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

KGF (FGF7) (NM_002009) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP21781)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.8 kDa

Amino Acid Sequence

MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For FGF7 (Source: Uniprot.org, NCBI)

Gene Name

FGF7

Full Name

Fibroblast growth factor 7

Weight

18.8 kDa

Superfamily

heparin-binding growth factors family

Alternative Names

FGF7; FGF-7; fibroblast growth factor 7HBGF-7; HBGF7; HBGF-7; Heparin-binding growth factor 7; keratinocyte growth factor; KGF; KGFfibroblast growth factor 7 (keratinocyte growth factor) FGF7 HBGF-7, KGF fibroblast growth factor 7 fibroblast growth factor 7|FGF-7|heparin-binding growth factor 7|keratinocyte growth factor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FGF7, check out the FGF7 Infographic

FGF7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FGF7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP21781

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used KGF (FGF7) (NM_002009) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For KGF (FGF7) (NM_002009) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for KGF (FGF7) (NM_002009) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP21781
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.