Kallikrein 5 (KLK5) (NM_001077491) Human Recombinant Protein

Kallikrein 5 protein,

Product Info Summary

SKU: PROTQ9Y337
Size: 20 µg
Source: HEK293T

Product Name

Kallikrein 5 (KLK5) (NM_001077491) Human Recombinant Protein

View all Kallikrein 5 recombinant proteins

SKU/Catalog Number

PROTQ9Y337

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human kallikrein-related peptidase 5 (KLK5), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Kallikrein 5 (KLK5) (NM_001077491) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y337)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

28.8 kDa

Amino Acid Sequence

MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS

Validation Images & Assay Conditions

Gene/Protein Information For KLK5 (Source: Uniprot.org, NCBI)

Gene Name

KLK5

Full Name

Kallikrein-5

Weight

28.8 kDa

Superfamily

peptidase S1 family

Alternative Names

EC 3.4.21; EC 3.4.21.4; Kallikrein 5; Kallikrein-like protein 2; kallikrein-related peptidase 5; KLK5; KLKL2; KLK-L2; KLK-L2EC 3.4.21.-; SCTE; SCTEkallikrein-5; Stratum corneum tryptic enzyme KLK5 KLK-L2, KLKL2, SCTE kallikrein related peptidase 5 kallikrein-5|kallikrein-like protein 2|stratum corneum tryptic enzyme

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on KLK5, check out the KLK5 Infographic

KLK5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KLK5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y337

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Kallikrein 5 (KLK5) (NM_001077491) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Kallikrein 5 (KLK5) (NM_001077491) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Kallikrein 5 (KLK5) (NM_001077491) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y337
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.