ITM2B (NM_021999) Human Recombinant Protein

ITM2B protein,

Recombinant protein of human integral membrane protein 2B (ITM2B)

Product Info Summary

SKU: PROTQ9Y287
Size: 20 µg
Source: HEK293T

Product Name

ITM2B (NM_021999) Human Recombinant Protein

View all ITM2B recombinant proteins

SKU/Catalog Number

PROTQ9Y287

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human integral membrane protein 2B (ITM2B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ITM2B (NM_021999) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y287)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.2 kDa

Amino Acid Sequence

MVKVTFNSALAQKETKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS

Validation Images & Assay Conditions

Gene/Protein Information For ITM2B (Source: Uniprot.org, NCBI)

Gene Name

ITM2B

Full Name

Integral membrane protein 2B

Weight

30.2 kDa

Superfamily

ITM2 family

Alternative Names

ABRI; ABri/ADan amyloid peptide; BRI; BRI2; BRICD2B; BRICHOS domain containing 2B; BRIFBD; E25B; E3-16; FBD; integral membrane protein 2B; ITM2B; Protein E25B; Transmembrane protein BRI ITM2B ABRI, BRI, BRI2, BRICD2B, E25B, E3-16, FBD, RDGCA, imBRI2 integral membrane protein 2B integral membrane protein 2B|ABri/ADan amyloid peptide|BRICHOS domain containing 2B|epididymis secretory sperm binding protein|immature BRI2|transmembrane protein BRI

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ITM2B, check out the ITM2B Infographic

ITM2B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ITM2B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y287

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ITM2B (NM_021999) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ITM2B (NM_021999) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ITM2B (NM_021999) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y287
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.