IRAK1BP1 (NM_001010844) Human Recombinant Protein

Irak1bp1 protein,

Recombinant protein of human interleukin-1 receptor-associated kinase 1 binding protein 1 (IRAK1BP1)

Product Info Summary

SKU: PROTQ5VVH5
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

IRAK1BP1 (NM_001010844) Human Recombinant Protein

View all Irak1bp1 recombinant proteins

SKU/Catalog Number

PROTQ5VVH5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human interleukin-1 receptor-associated kinase 1 binding protein 1 (IRAK1BP1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

IRAK1BP1 (NM_001010844) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ5VVH5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

28.9 kDa

Amino Acid Sequence

MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHPLSSTQAQTATREVQVSGTSEVSAGPDRAQVVVRVSSTKEAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVENAYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVISPPQFYHTPGSVENLRRQACLVAVENAWRKAQEVCNLVGQTLGKPLLIKEEETKEWEGQIDDHQSSRLSSSLTVQQKIKSATIHAASKVFITFEVKGKEKRKKHL

Validation Images & Assay Conditions

Gene/Protein Information For Irak1bp1 (Source: Uniprot.org, NCBI)

Gene Name

Irak1bp1

Full Name

Interleukin-1 receptor-associated kinase 1-binding protein 1

Weight

28.9 kDa

Superfamily

IRAK1BP1 family

Alternative Names

ActA binding protein 3,4921528N06Rik; AIP70; interleukin-1 receptor-associated kinase 1 binding protein 1; interleukin-1 receptor-associated kinase 1-binding protein 1; MGC138458; MGC138460; SIMPL Irak1bp1|4921528N06Rik, AI, AI851240, Aabp3, Aip70, S, Simpl|interleukin-1 receptor-associated kinase 1 binding protein 1|interleukin-1 receptor-associated kinase 1-binding protein 1|Acta binding protein 3|Acta-binding protein 70|IRAK1-binding protein 1|Plk-interacting protein|signaling molecule that associates with the mouse pelle-like kinase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Irak1bp1, check out the Irak1bp1 Infographic

Irak1bp1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Irak1bp1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ5VVH5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used IRAK1BP1 (NM_001010844) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For IRAK1BP1 (NM_001010844) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for IRAK1BP1 (NM_001010844) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ5VVH5
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.