IL37 Interleukin-37 Human Recombinant Protein

IL-37/IL-1F7 protein, Human

Interleukin-37 Human Recombinant produced in E. coli is a single, non-glycosylated, Polypeptide chain containing 167 amino acids (Lys27-Asp192) and having a molecular mass of 18.6kDa. The IL37 is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTQ9NZH6
Size: 3x2ug, 25ug, 1mg
Origin Species: Human
Source: Escherichia coli

Customers Who Bought This Also Bought

Product Name

IL37 Interleukin-37 Human Recombinant Protein

View all IL-37/IL-1F7 recombinant proteins

SKU/Catalog Number

PROTQ9NZH6

Size

3x2ug, 25ug, 1mg

Description

Interleukin-37 Human Recombinant produced in E. coli is a single, non-glycosylated, Polypeptide chain containing 167 amino acids (Lys27-Asp192) and having a molecular mass of 18.6kDa. The IL37 is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized IL37 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-37 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

Cite This Product

IL37 Interleukin-37 Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NZH6)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

IL37 was lyophilized from a 0.2μM filtered solution of 20mM PB, 150mM NaCl and 2mM DTT pH 7.4.

Purity

Greater than 95.0% as determined by SDS-PAGE.

Predicted MW

24.126kDa

Reconstitution

It is recommended to quick spin followed by reconstitution of IL37 in PBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Amino Acid Sequence

MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYR

Biological Activity

As measured by its binding ability in a functional ELISA, immobilized IL1F7 at 1 µg/ml (100 µl/well) can bind rhIL-18 R/Fc Chimera with a linear range of 0.015-1µg/ml.

Reconstitution

It is recommended to quick spin followed by reconstitution of IL37 in PBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Validation Images & Assay Conditions

Gene/Protein Information For IL37 (Source: Uniprot.org, NCBI)

Gene Name

IL37

Full Name

Interleukin-37

Weight

24.126kDa

Superfamily

IL-1 family

Alternative Names

Interleukin-37; FIL1 zeta; IL-1X; Interleukin-1 family member 7; IL-1F7; Interleukin-1 homolog 4; IL-1H; IL-1H4; Interleukin-1 zeta; IL-1 zeta; Interleukin-1-related protein; IL-1RP1; Interleukin-23; IL-37; IL37; FIL1Z; IL1F7; IL1H4; IL1RP1; FIL1; FIL1(ZETA) IL37 FIL1, FIL1(ZETA), FIL1Z, IL-1F7, IL-1H, IL-1H4, IL-1RP1, IL-23, IL-37, IL1F7, IL1H4, IL1RP1 interleukin 37 interleukin-37|FIL1 zeta|IL-1 zeta|IL-1F7b (IL-1H4, IL-1H, IL-1RP1)|IL-1X protein|IL1F7 (canonical product IL-1F7b)|interleukin 1 family member 7|interleukin 1, zeta|interleukin-1 homolog 4|interleukin-1 superfamily z|interleukin-1-related protein|interleukin-23

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IL37, check out the IL37 Infographic

IL37 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IL37: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NZH6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used IL37 Interleukin-37 Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For IL37 Interleukin-37 Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for IL37 Interleukin-37 Human Recombinant Protein

Size

Total: $250

SKU:PROTQ9NZH6

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTQ9NZH6
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product