IL17F Interleukin-17F Mouse Recombinant Protein

IL-17F protein, Mouse

IL17F Mouse Recombinant produced in E. coli is a homodimeric, non-glycosylated polypeptide chain containing a total of 266 amino acids and having a molecular mass of 29.8 kDa. The Mouse IL-17F is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTQ7TNI7
Size: 5ug, 25ug, 1mg
Origin Species: Mouse
Source: Escherichia coli

Product Name

IL17F Interleukin-17F Mouse Recombinant Protein

View all IL-17F recombinant proteins

SKU/Catalog Number

PROTQ7TNI7

Size

5ug, 25ug, 1mg

Description

IL17F Mouse Recombinant produced in E. coli is a homodimeric, non-glycosylated polypeptide chain containing a total of 266 amino acids and having a molecular mass of 29.8 kDa. The Mouse IL-17F is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17F should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Cite This Product

IL17F Interleukin-17F Mouse Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ7TNI7)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

IL17F was lyophilized from a concentrated (1mg/ml) solution containing no additives.

Purity

Greater than 97.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.

Reconstitution

It is recommended to reconstitute the lyophilized Mouse IL17F in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Amino Acid Sequence

RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP WDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRR EPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA

Reconstitution

It is recommended to reconstitute the lyophilized Mouse IL17F in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Validation Images & Assay Conditions

Gene/Protein Information For IL17F (Source: Uniprot.org, NCBI)

Gene Name

IL17F

Full Name

Interleukin-17F

Weight

Superfamily

IL-17 family

Alternative Names

Cytokine ML-1; IL17F; IL-17F; IL-17Finterleukin-17F; IL24; IL-24; interleukin 17F; Interleukin-24; ML-1; ML1interleukin-24 IL17F CANDF6, IL-17F, ML-1, ML1 interleukin 17F interleukin-17F|cytokine ML-1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IL17F, check out the IL17F Infographic

IL17F infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IL17F: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ7TNI7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used IL17F Interleukin-17F Mouse Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For IL17F Interleukin-17F Mouse Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for IL17F Interleukin-17F Mouse Recombinant Protein

Size

Total: $250

SKU:PROTQ7TNI7

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTQ7TNI7
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.