Click image to see more details
Product Info Summary
| SKU: | PROTQ7TNI7 |
|---|---|
| Size: | 5ug, 25ug, 1mg |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
IL17F Interleukin-17F Mouse Recombinant Protein
View all IL-17F recombinant proteins
SKU/Catalog Number
PROTQ7TNI7
Size
5ug, 25ug, 1mg
Description
IL17F Mouse Recombinant produced in E. coli is a homodimeric, non-glycosylated polypeptide chain containing a total of 266 amino acids and having a molecular mass of 29.8 kDa. The Mouse IL-17F is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17F should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Cite This Product
IL17F Interleukin-17F Mouse Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ7TNI7)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
IL17F was lyophilized from a concentrated (1mg/ml) solution containing no additives.
Purity
Greater than 97.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Predicted MW
18.045kDa
Reconstitution
It is recommended to reconstitute the lyophilized Mouse IL17F in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP WDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRR EPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized Mouse IL17F in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For IL17F (Source: Uniprot.org, NCBI)
Gene Name
IL17F
Full Name
Interleukin-17F
Weight
18.045kDa
Superfamily
IL-17 family
Alternative Names
Cytokine ML-1; IL-17F; Interleukin-17F precursor; IL17F; ML1; ML-1 IL17F CANDF6, IL-17F, ML-1, ML1 interleukin 17F interleukin-17F|cytokine ML-1
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL17F, check out the IL17F Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL17F: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For IL17F Interleukin-17F Mouse Recombinant Protein (PROTQ7TNI7)
Hello CJ!
No publications found for PROTQ7TNI7
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used IL17F Interleukin-17F Mouse Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For IL17F Interleukin-17F Mouse Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
