Product Info Summary
SKU: | PROTQ7TNI7 |
---|---|
Size: | 5ug, 25ug, 1mg |
Origin Species: | Mouse |
Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
IL17F Interleukin-17F Mouse Recombinant Protein
View all IL-17F recombinant proteins
SKU/Catalog Number
PROTQ7TNI7
Size
5ug, 25ug, 1mg
Description
IL17F Mouse Recombinant produced in E. coli is a homodimeric, non-glycosylated polypeptide chain containing a total of 266 amino acids and having a molecular mass of 29.8 kDa. The Mouse IL-17F is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17F should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Cite This Product
IL17F Interleukin-17F Mouse Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ7TNI7)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
IL17F was lyophilized from a concentrated (1mg/ml) solution containing no additives.
Purity
Greater than 97.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Reconstitution
It is recommended to reconstitute the lyophilized Mouse IL17F in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP WDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRR EPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized Mouse IL17F in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
![recombinant protein thumbnail_1 recombinant protein thumbnail_1](https://www.bosterbio.com/media/catalog/product/r/e/recombinant-protein-thumbnail_1.png)
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For IL17F (Source: Uniprot.org, NCBI)
Gene Name
IL17F
Full Name
Interleukin-17F
Weight
Superfamily
IL-17 family
Alternative Names
Cytokine ML-1; IL17F; IL-17F; IL-17Finterleukin-17F; IL24; IL-24; interleukin 17F; Interleukin-24; ML-1; ML1interleukin-24 IL17F CANDF6, IL-17F, ML-1, ML1 interleukin 17F interleukin-17F|cytokine ML-1
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL17F, check out the IL17F Infographic
![IL17F infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL17F: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For IL17F Interleukin-17F Mouse Recombinant Protein (PROTQ7TNI7)
Hello CJ!
No publications found for PROTQ7TNI7
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used IL17F Interleukin-17F Mouse Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For IL17F Interleukin-17F Mouse Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question