Product Info Summary
SKU: | PROTP35225 |
---|---|
Size: | 2ug, 10ug, 1mg |
Origin Species: | Human |
Source: | Escherichia coli |
Customers Who Bought This Also Bought
Product info
Product Name
IL-13 Interleukin-13 Human Recombinant Protein
View all IL-13 recombinant proteins
SKU/Catalog Number
PROTP35225
Size
2ug, 10ug, 1mg
Description
Interleukin-13 Human Recombinant produced in E. coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa. The IL-13 is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Cite This Product
IL-13 Interleukin-13 Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP35225)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
The protein (1mg/ml) was lyophilized with 1xPBS pH-7.2 & 5% trehalose.
Purity
Greater than 95% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Predicted MW
15.816kDa
Reconstitution
It is recommended to reconstitute the lyophilized Interleukin 13 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Amino Acid Sequence
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVS GCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFRE GRFN
Biological Activity
The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be less than 1ng/ml, corresponding to a specific activity of greater than 1 x 106units/mg.
Assay dilution & Images
Reconstitution
It is recommended to reconstitute the lyophilized Interleukin 13 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For IL13 (Source: Uniprot.org, NCBI)
Gene Name
IL13
Full Name
Interleukin-13
Weight
15.816kDa
Superfamily
IL-4/IL-13 family
Alternative Names
NC30; ALRH; BHR1; P600; IL-13; MGC116786; MGC116788; MGC116789 IL13 IL-13, P600 interleukin 13 interleukin-13
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL13, check out the IL13 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL13: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For IL-13 Interleukin-13 Human Recombinant Protein (PROTP35225)
Hello CJ!
No publications found for PROTP35225
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used IL-13 Interleukin-13 Human Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For IL-13 Interleukin-13 Human Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question