IL-13 Interleukin-13 Human Recombinant Protein

IL-13 protein, Human

Interleukin-13 Human Recombinant produced in E. coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa. The IL-13 is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTP35225
Size: 2ug, 10ug, 1mg
Origin Species: Human
Source: Escherichia coli

Product Name

IL-13 Interleukin-13 Human Recombinant Protein

View all IL-13 recombinant proteins

SKU/Catalog Number

PROTP35225

Size

2ug, 10ug, 1mg

Description

Interleukin-13 Human Recombinant produced in E. coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa. The IL-13 is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Cite This Product

IL-13 Interleukin-13 Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP35225)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

The protein (1mg/ml) was lyophilized with 1xPBS pH-7.2 & 5% trehalose.

Purity

Greater than 95% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.

Predicted MW

15.816kDa

Reconstitution

It is recommended to reconstitute the lyophilized Interleukin 13 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Amino Acid Sequence

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVS GCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFRE GRFN

Biological Activity

The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be less than 1ng/ml, corresponding to a specific activity of greater than 1 x 106units/mg.

Reconstitution

It is recommended to reconstitute the lyophilized Interleukin 13 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Validation Images & Assay Conditions

Gene/Protein Information For IL13 (Source: Uniprot.org, NCBI)

Gene Name

IL13

Full Name

Interleukin-13

Weight

15.816kDa

Superfamily

IL-4/IL-13 family

Alternative Names

NC30; ALRH; BHR1; P600; IL-13; MGC116786; MGC116788; MGC116789 IL13 IL-13, P600 interleukin 13 interleukin-13

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IL13, check out the IL13 Infographic

IL13 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IL13: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP35225

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used IL-13 Interleukin-13 Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For IL-13 Interleukin-13 Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for IL-13 Interleukin-13 Human Recombinant Protein

Size

Total: $250

SKU:PROTP35225

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTP35225
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.