IFITM5 (NM_001025295) Human Recombinant Protein

Ifitm5 protein,

Recombinant protein of human interferon induced transmembrane protein 5 (IFITM5)

Product Info Summary

SKU: PROTA6NNB3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

IFITM5 (NM_001025295) Human Recombinant Protein

View all Ifitm5 recombinant proteins

SKU/Catalog Number

PROTA6NNB3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human interferon induced transmembrane protein 5 (IFITM5)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

IFITM5 (NM_001025295) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA6NNB3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.2 kDa

Amino Acid Sequence

MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYSIKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAAFFSTKFDDADYD

Validation Images & Assay Conditions

Gene/Protein Information For IFITM5 (Source: Uniprot.org, NCBI)

Gene Name

IFITM5

Full Name

Interferon-induced transmembrane protein 5

Weight

14.2 kDa

Superfamily

CD225/Dispanin family

Alternative Names

bone-restricted interferon induced transmembrane protein-like protein; bone-restricted interferon-induced transmembrane protein-like protein; BRIL; Hrmp1; interferon induced transmembrane protein 5; interferon-induced transmembrane protein 5 Ifitm5|1110003J06Rik, AW213665, B, Bril, DSPA1, Hrm, Hrmp1, Hrtm1, fra|interferon induced transmembrane protein 5|interferon-induced transmembrane protein 5|bone-restricted interferon induced transmembrane protein-like protein|dispanin subfamily A member 1|fragilis family member 4|haemopoiesis related membrane protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IFITM5, check out the IFITM5 Infographic

IFITM5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IFITM5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used IFITM5 (NM_001025295) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For IFITM5 (NM_001025295) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for IFITM5 (NM_001025295) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTA6NNB3
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.