Click image to see more details
Product Info Summary
| SKU: | PROTQ13253-6 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | HEK293 cell |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant Noggin protein, AF
View all Noggin recombinant proteins
SKU/Catalog Number
PROTQ13253-6
Size
5ug,20ug,100ug
Tag
Fc Tag (C-term)
Description
Noggin is a 46.2 kDa bioactive protein, which exists as a disulfide-linked homodimer (each chain 23.1 kDa). Noggin binds members of the transforming Growth Factors-beta (TGF beta) superfamily signaling proteins, such as bone morphogenetic protein-4 (BMP-4), which inactivates their activities. As a extracellular antagonist of BMP proteins, Noggin involves in the development of many body tissues, including nerve tissue, muscles, and bones. In addition, Noggin is able to inhibit chondrocyte differentiation through its interaction with GDF5.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant Noggin protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13253-6)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
25.774kDa
Molecular weight
The protein has a calculated MW of 49.11 kDa. The protein migrates as 58 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <0.05 μg/mL in the presence of 50 ng/mL of recombinant human BMP-4.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC with Fc tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human Noggin
Protein Target Info & Infographic
Gene/Protein Information For NOG (Source: Uniprot.org, NCBI)
Gene Name
NOG
Full Name
Noggin
Weight
25.774kDa
Superfamily
noggin family
Alternative Names
NOG, Noggin, SYM1, symphalangism 1 (proximal), synostoses (multiple) syndrome 1, SYNS1, SYNS1A NOG SYM1, SYNS1, SYNS1A noggin noggin|symphalangism 1 (proximal)
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on NOG, check out the NOG Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for NOG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant Noggin protein, AF (PROTQ13253-6)
Hello CJ!
No publications found for PROTQ13253-6
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant Noggin protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant Noggin protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
