Click image to see more details
Product Info Summary
| SKU: | PROTP09237-3 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant MMP7 (active) protein, AF
View all MMP-7 recombinant proteins
SKU/Catalog Number
PROTP09237-3
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Active matrix metalloproteinase-7 (Active MMP-7) is a 20.07 kDa matrix metalloproteinases with 180 amino acid residues. MMP-7 restricted production by normal mucosal and exocrine gland epithelial cells, as well as by carcinoma cells. Functionally, it involved breakdown of extracellular matrix (casein, gelatins of types I, III, IV, and V, and fibronectin) in normal physiological processes and disease processes. MMP-7 is contributed to early tumor development during carcinogenesis.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant MMP7 (active) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP09237-3)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
29.677kDa
Molecular weight
The protein has a calculated MW of 20.07 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Activity
Testing in process
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human MMP7 (active)
Protein Target Info & Infographic
Gene/Protein Information For MMP7 (Source: Uniprot.org, NCBI)
Gene Name
MMP7
Full Name
Matrilysin
Weight
29.677kDa
Superfamily
peptidase M10A family
Alternative Names
MMP-7, MPSL1, PUMP-1 MMP7 MMP-7, MPSL1, PUMP-1 matrix metallopeptidase 7 matrilysin|matrin|matrix metallopeptidase 7 (matrilysin, uterine)|matrix metalloproteinase 7 (matrilysin, uterine)|matrix metalloproteinase-7|pump-1 protease|uterine matrilysin|uterine metalloproteinase
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on MMP7, check out the MMP7 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for MMP7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant MMP7 (active) protein, AF (PROTP09237-3)
Hello CJ!
No publications found for PROTP09237-3
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant MMP7 (active) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant MMP7 (active) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
