Human recombinant MIF (Macrophage migration inhibitory factor) protein, AF

MIF protein, Human

Macrophage migration inhibitory factor (MIF) is a pleiotropic inflammatory mediator, predicts a molecular mass of 12.5 kDa. MIF binds to CD74, a type II transmembrane protein, inducing its phosphorylation and the recruitment of CD44, which then activates SRC family non-receptor tyrosine kinases, leading to ERK1 /2 phosphorylation.

Product Info Summary

SKU: PROTP14174-9
Size: 5ug,20ug,100ug
Origin Species: Human
Source: Escherichia coli
Application: Cell Culture

Product Name

Human recombinant MIF (Macrophage migration inhibitory factor) protein, AF

View all MIF recombinant proteins

SKU/Catalog Number

PROTP14174-9

Size

5ug,20ug,100ug

Tag

His Tag (C-term)

Description

Macrophage migration inhibitory factor (MIF) is a pleiotropic inflammatory mediator, predicts a molecular mass of 12.5 kDa. MIF binds to CD74, a type II transmembrane protein, inducing its phosphorylation and the recruitment of CD44, which then activates SRC family non-receptor tyrosine kinases, leading to ERK1 /2 phosphorylation.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Human recombinant MIF (Macrophage migration inhibitory factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP14174-9)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

12.476kDa

Molecular weight

The protein has a calculated MW of 13.28 kDa. The protein migrates as 10 kDa under reducing condition (SDS-PAGE analysis).

Activity

Testing in process

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For MIF (Source: Uniprot.org, NCBI)

Gene Name

MIF

Full Name

Macrophage migration inhibitory factor

Weight

12.476kDa

Superfamily

MIF family

Alternative Names

GLIF, mMIF, GIF, Glycosylation-inhibiting factor MIF GIF, GLIF, MMIF macrophage migration inhibitory factor macrophage migration inhibitory factor|L-dopachrome isomerase|L-dopachrome tautomerase|epididymis secretory sperm binding protein|macrophage migration inhibitory factor (glycosylation-inhibiting factor)|phenylpyruvate tautomerase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MIF, check out the MIF Infographic

MIF infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MIF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP14174-9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Human recombinant MIF (Macrophage migration inhibitory factor) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Human recombinant MIF (Macrophage migration inhibitory factor) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Human recombinant MIF (Macrophage migration inhibitory factor) protein, AF

Size

Total: $77

SKU:PROTP14174-9

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP14174-9
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.