Click image to see more details
Product Info Summary
| SKU: | PROTP15018-8 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant LIF protein, AF
View all LIF recombinant proteins
SKU/Catalog Number
PROTP15018-8
Size
5ug,20ug,100ug
Tag
His Tag (N-term)
Description
Leukemia inhibitory factor (LIF) is a pleiotropic glycoprotein, belonging to the IL-6 receptor family. LIF is a 19.7 kDa protein containing 202 amino acid which high expression in human liver, bone, uterus, kidney and the central nervous system. LIF is an inducer of differentiation in M1 leukemia cells, osteoblasts and glia. Not only stimulates proliferation of DA1 cells inhibits proliferation of corticotrophs and promote cell survival in some cell types but also induce apoptosis in others.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant LIF protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP15018-8)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
22.008kDa
Molecular weight
The protein has a calculated MW of 20.52 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <0.2 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human LIF
Protein Target Info & Infographic
Gene/Protein Information For LIF (Source: Uniprot.org, NCBI)
Gene Name
LIF
Full Name
Leukemia inhibitory factor
Weight
22.008kDa
Superfamily
LIF/OSM family
Alternative Names
Differentiation-stimulating factor, D factor, Melanoma-derived LPL inhibitor (MLPLI), Interleukin 6 family cytokine LIF CDF, DIA, HILDA, MLPLI LIF interleukin 6 family cytokine leukemia inhibitory factor|D factor|cholinergic differentiation factor|differentiation inhibitory activity|differentiation-inducing factor|differentiation-stimulating factor|hepatocyte-stimulating factor III|human interleukin in DA cells|melanoma-derived LPL inhibitor
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on LIF, check out the LIF Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for LIF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant LIF protein, AF (PROTP15018-8)
Hello CJ!
No publications found for PROTP15018-8
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant LIF protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant LIF protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
