Click image to see more details
Product Info Summary
| SKU: | PROTP13232-10 |
|---|---|
| Size: | 100ug,1mg |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture, ELISA |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant IL-7 protein, GMP
View all IL-7 recombinant proteins
SKU/Catalog Number
PROTP13232-10
Size
100ug,1mg
Tag
His Tag (C-term)
Description
Interleukin-7 (IL-7) is a multipotent cytokine belonged to one of the members of IL-2 superfamily. IL-7 has diverse effects on the hematopoietic and immune regulations. IL-7 is a trophic factor that is necessary for both B cell and T cell proliferation and development. In addition, it presents potential antitumor effects in tumors such as glioma, melanoma, lymphoma, leukemia, prostate cancer, and glioblastoma.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant IL-7 protein, GMP (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP13232-10)
Form
Lyophilized
Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.
Purity
>95% as determined by SDS-PAGE analysis.
Predicted MW
20.187kDa
Molecular weight
The protein has a calculated MW of 18.3 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measured by its ability to induce PHA-activated human PBMCs proliferation. The ED₅₀ for this effect is <0.8 ng/mL. The specific activity of recombinant human IL-7 is > 1 x 10⁸ units/mg.
Endotoxin
<0.05 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of GMP human IL-7
Protein Target Info & Infographic
Gene/Protein Information For IL7 (Source: Uniprot.org, NCBI)
Gene Name
IL7
Full Name
Interleukin-7
Weight
20.187kDa
Superfamily
IL-7/IL-9 family
Alternative Names
Lymphopoietin 1(LP-1), pre-B-cell factor IL7 IL-7 interleukin 7 interleukin-7
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL7, check out the IL7 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant IL-7 protein, GMP (PROTP13232-10)
Hello CJ!
No publications found for PROTP13232-10
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant IL-7 protein, GMP?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant IL-7 protein, GMP
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
