No images for this product yet
Product Info Summary
| SKU: | PROTP05231-8 |
|---|---|
| Size: | 5ug,20ug,100ug,500ug,1mg |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant IL-6 (Interleukin-6) protein, AF
View all IL-6 recombinant proteins
SKU/Catalog Number
PROTP05231-8
Size
5ug,20ug,100ug,500ug,1mg
Tag
His Tag (C-term)
Description
Interleukin-6 (IL-6) is a pleiotropic, 22-28 kDa cytokine which plays fundamental role in the acute phase response, inflammation, bone metabolism, lymphocyte differentiation and cancer progression. Deregulation of IL-6 production was also found in several diseases, including rheumatoid arthritis, Alzheimer’s disease, autoimmune deficiency disease and different types of cancer.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant IL-6 (Interleukin-6) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP05231-8)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
23.718kDa
Molecular weight
The protein has a calculated MW of 21.8 kDa. The protein migrates as 22 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce proliferation in TF-1 cells. The ED₅₀ for this effect is <0.5 ng/mL. The specific activity of recombinant human IL-6 is approximately >5 x 10⁸ IU/mg. Measure by its ability to induce proliferation in MCF-7 cells. The ED₅₀ for this effect is <4.4 ng/mL.
Activity
Measure by its ability to induce proliferation in TF-1 cells. The ED₅₀ for this effect is <0.5 ng/mL. The specific activity of recombinant human IL-6 is approximately >5 x 10⁸ IU/mg. Measure by its ability to induce proliferation in MCF-7 cells. The ED₅₀ for this effect is <4.4 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM with polyhistidine tag at the C-terminus.
Assay dilution & Images
Validation Images & Assay Conditions
There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.
Protein Target Info & Infographic
Gene/Protein Information For IL6 (Source: Uniprot.org, NCBI)
Gene Name
IL6
Full Name
Interleukin-6
Weight
23.718kDa
Superfamily
IL-6 superfamily
Alternative Names
B cell stimulatory factor-2; B-cell differentiation factor; BSF2; BSF-2; BSF2CTL differentiation factor; CDF; HGFHSFIFNB2Hybridoma growth factor; IFNB2; IFN-beta-2; IL6; IL-6; IL-6B-cell stimulatory factor 2; Interferon beta-2; interleukin 6 (interferon, beta 2); interleukin BSF-2; interleukin-6; MGI-2A IL6 BSF-2, BSF2, CDF, HGF, HSF, IFN-beta-2, IFNB2, IL-6 interleukin 6 interleukin-6|B-cell differentiation factor|B-cell stimulatory factor 2|CTL differentiation factor|hybridoma growth factor|interferon beta-2|interleukin BSF-2
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL6, check out the IL6 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant IL-6 (Interleukin-6) protein, AF (PROTP05231-8)
Hello CJ!
No publications found for PROTP05231-8
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant IL-6 (Interleukin-6) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant IL-6 (Interleukin-6) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
