Product Info Summary
SKU: | PROTQ9NZH7-3 |
---|---|
Size: | 5ug,20ug,100ug |
Origin Species: | Human |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant IL-36 beta (Interleukin-36 beta) protein, AF
View all IL-36 beta/IL-1F8 recombinant proteins
SKU/Catalog Number
PROTQ9NZH7-3
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Interleukin-36 beta (IL-36β) is an 18 kDa cytokine with 154 amino acid residues. IL-36β, the ligand of IL-36R, is expressed in keratinocytes and plays a significant role in inflammatory responses. IL-36β regulates biological functions like the differentiation of T cells. Moreover, IL-36β recruits neutrophils via inducing the expression of cytokines and chemokines, such as IL-17C, granulocyte colony-stimulating factor (G-CSF), IL-8, CXCL-1, and tumor necrosis factor (TNF).
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant IL-36 beta (Interleukin-36 beta) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NZH7-3)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
18.522kDa
Molecular weight
The protein has a calculated MW of 18.17 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce IL-8 secretion in human PBMCs. The ED₅₀ for this effect is <0.2 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human IL-36 beta
Protein Target Info & Infographic
Gene/Protein Information For IL36B (Source: Uniprot.org, NCBI)
Gene Name
IL36B
Full Name
Interleukin-36 beta
Weight
18.522kDa
Superfamily
IL-1 family
Alternative Names
IL-1F8, IL-1H2, IL-1 eta IL36B FIL1, FIL1-(ETA), FIL1H, FILI-(ETA), IL-1F8, IL-1H2, IL1-ETA, IL1F8, IL1H2 interleukin 36 beta interleukin-36 beta|FIL1 eta|IL-1 eta|IL-1F8 (FIL1-eta)|IL1F8 (Canonical product IL-1F8a)|Interleukin-1 Superfamily e|family of interleukin 1-eta|interleukin 1 family, member 8 (eta)|interleukin-1 eta|interleukin-1 family member 8|interleukin-1 homolog 2
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL36B, check out the IL36B Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL36B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant IL-36 beta (Interleukin-36 beta) protein, AF (PROTQ9NZH7-3)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant IL-36 beta (Interleukin-36 beta) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant IL-36 beta (Interleukin-36 beta) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question