Human recombinant IL-36 beta (Interleukin-36 beta) protein, AF

IL-36 beta/IL-1F8 protein, Human

Interleukin-36 beta (IL-36β) is an 18 kDa cytokine with 154 amino acid residues. IL-36β, the ligand of IL-36R, is expressed in keratinocytes and plays a significant role in inflammatory responses. IL-36β regulates biological functions like the differentiation of T cells. Moreover, IL-36β recruits neutrophils via inducing the expression of cytokines and chemokines, such as IL-17C, granulocyte colony-stimulating factor (G-CSF), IL-8, CXCL-1, and tumor necrosis factor (TNF).

Product Info Summary

SKU: PROTQ9NZH7-3
Size: 5ug,20ug,100ug
Origin Species: Human
Source: Escherichia coli
Application: Cell Culture

Product Name

Human recombinant IL-36 beta (Interleukin-36 beta) protein, AF

View all IL-36 beta/IL-1F8 recombinant proteins

SKU/Catalog Number

PROTQ9NZH7-3

Size

5ug,20ug,100ug

Tag

His Tag (C-term)

Description

Interleukin-36 beta (IL-36β) is an 18 kDa cytokine with 154 amino acid residues. IL-36β, the ligand of IL-36R, is expressed in keratinocytes and plays a significant role in inflammatory responses. IL-36β regulates biological functions like the differentiation of T cells. Moreover, IL-36β recruits neutrophils via inducing the expression of cytokines and chemokines, such as IL-17C, granulocyte colony-stimulating factor (G-CSF), IL-8, CXCL-1, and tumor necrosis factor (TNF).

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Human recombinant IL-36 beta (Interleukin-36 beta) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NZH7-3)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

18.522kDa

Molecular weight

The protein has a calculated MW of 18.17 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED₅₀ for this effect is <0.2 ng/mL.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For IL36B (Source: Uniprot.org, NCBI)

Gene Name

IL36B

Full Name

Interleukin-36 beta

Weight

18.522kDa

Superfamily

IL-1 family

Alternative Names

IL-1F8, IL-1H2, IL-1 eta IL36B FIL1, FIL1-(ETA), FIL1H, FILI-(ETA), IL-1F8, IL-1H2, IL1-ETA, IL1F8, IL1H2 interleukin 36 beta interleukin-36 beta|FIL1 eta|IL-1 eta|IL-1F8 (FIL1-eta)|IL1F8 (Canonical product IL-1F8a)|Interleukin-1 Superfamily e|family of interleukin 1-eta|interleukin 1 family, member 8 (eta)|interleukin-1 eta|interleukin-1 family member 8|interleukin-1 homolog 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IL36B, check out the IL36B Infographic

IL36B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IL36B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used Human recombinant IL-36 beta (Interleukin-36 beta) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Human recombinant IL-36 beta (Interleukin-36 beta) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Human recombinant IL-36 beta (Interleukin-36 beta) protein, AF

Size

Total: $77

SKU:PROTQ9NZH7-3

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTQ9NZH7-3
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.