Click image to see more details
Product Info Summary
| SKU: | PROTQ8IU54-7 |
|---|---|
| Size: | 5ug,20ug,100ug,500ug,1mg |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant IL-29 (Interleukin-29) protein, AF
View all IL-29/IFN-lambda 1 recombinant proteins
SKU/Catalog Number
PROTQ8IU54-7
Size
5ug,20ug,100ug,500ug,1mg
Tag
His Tag (C-term)
Description
Interleukin 29 (IL-29) is a cytokine, predicts a molecular mass of 21.9 kDa. It belongs to type III interferons group, also termed interferons λ (IFN-λ). Its induction of STAT3-STAT5 has also been displayed, albeit to a lesser degree. The STAT1 /STAT2 signaling cascade transpires as follows: once tyrosine residues on STAT1 and STAT2 are phosphorylated, these proteins dimerize and are subsequently transported to the nucleus.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant IL-29 (Interleukin-29) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8IU54-7)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
21.898kDa
Molecular weight
The protein has a calculated MW of 20.70 kDa. The protein migrates as 22 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce IL-8 secretion in HuH7 cells. The ED₅₀ for this effect is <6 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human IL-29
Protein Target Info & Infographic
Gene/Protein Information For IFNL1 (Source: Uniprot.org, NCBI)
Gene Name
IFNL1
Full Name
Interferon lambda-1
Weight
21.898kDa
Superfamily
lambda interferon family
Alternative Names
IFN-λ1 IFNL1 IL-29, IL29 interferon lambda 1 interferon lambda-1|IFN-lambda-1|cytokine Zcyto21|interleukin 29 (interferon, lambda 1)|interleukin-29
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IFNL1, check out the IFNL1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IFNL1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant IL-29 (Interleukin-29) protein, AF (PROTQ8IU54-7)
Hello CJ!
No publications found for PROTQ8IU54-7
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant IL-29 (Interleukin-29) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant IL-29 (Interleukin-29) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
