Click image to see more details
Product Info Summary
| SKU: | PROTQ8IZI9-3 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant IL-28B (Interleukin-28B) protein, AF
View all IL-28B/IFN-lambda 3 recombinant proteins
SKU/Catalog Number
PROTQ8IZI9-3
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Interleukin-28B (IL-28B, now known as Interferon Lambda 3, IFN-λ3) is a 19.77 kDa member of type III IFN family with 176 amino acid residues. IL-28B is expressed by epithelial tissues. Cytokine with antiviral, antitumor and immunomodulatory activities. Able to activate JAK/STAT signaling pathway via binding its receptor IFNLR1 in epithelial cells.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant IL-28B (Interleukin-28B) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8IZI9-3)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
21.706kDa
Molecular weight
The protein has a calculated MW of 25.57 kDa. The protein migrates as 21 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED₅₀ for this effect is <5 ng/mL.
Endotoxin
<0.01 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human IL-28B
Protein Target Info & Infographic
Gene/Protein Information For IFNL3 (Source: Uniprot.org, NCBI)
Gene Name
IFNL3
Full Name
Interferon lambda-3
Weight
21.706kDa
Superfamily
lambda interferon family
Alternative Names
interferon lambda 3, IFNL3, IFN-lambda-3, IFN-lambda-4, IL-28C, IL28C IFNL3 IFN-lambda-3, IFN-lambda-4, IL-28B, IL-28C, IL28B, IL28C interferon lambda 3 interferon lambda-3|cytokine Zcyto22|interferon, lambda 4|interleukin-28B|interleukin-28C
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IFNL3, check out the IFNL3 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IFNL3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant IL-28B (Interleukin-28B) protein, AF (PROTQ8IZI9-3)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant IL-28B (Interleukin-28B) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant IL-28B (Interleukin-28B) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
