Click image to see more details
Product Info Summary
| SKU: | PROTP05000-3 |
|---|---|
| Size: | 20ug,100ug,500ug,1mg |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant IFN omega (interferon omega) protein, AF
View all IFNW1 recombinant proteins
SKU/Catalog Number
PROTP05000-3
Size
20ug,100ug,500ug,1mg
Tag
His Tag (C-term)
Description
Interferon Omega (IFN-ω) is a 20.12 kDa member of type I IFN family with 173 amino acid residues. IL-28B is expressed by epithelial tissues. IFN-ω with antiviral, antitumor activity and regulating the innate immune response. Able to activate P13K/Akt signaling pathway via binding its receptor IFNAR in cells.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant IFN omega (interferon omega) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP05000-3)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
22.319kDa
Molecular weight
The protein has a calculated MW of 20.93 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce cytotoxicity in TF-1 cells. The ED₅₀ for this effect is <0.02 ng/mL. The specific activity of recombinant human IFN omega is approximately >5 x10⁷ IU/ mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human IFN omega
Protein Target Info & Infographic
Gene/Protein Information For IFNW1 (Source: Uniprot.org, NCBI)
Gene Name
IFNW1
Full Name
Interferon omega-1
Weight
22.319kDa
Superfamily
alpha/beta interferon family
Alternative Names
IFN alpha II-1, IFNW1 IFNW1 interferon omega 1 interferon omega-1|IFN-omega 1, interferon omega-1|interferon alpha-II-1
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IFNW1, check out the IFNW1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IFNW1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant IFN omega (interferon omega) protein, AF (PROTP05000-3)
Hello CJ!
No publications found for PROTP05000-3
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant IFN omega (interferon omega) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant IFN omega (interferon omega) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
