Human recombinant IFN gamma protein, GMP

IFN-gamma protein, Human

The cytokine IFN gamma could protect cells from viral infections and belongs to the family of interferons. A lot of studies have shown that IFN gamma secreted by antigen triggered cell types, including T cells, naive CD4+ T cells, macrophages, dendritic cells, and B cells. IFN gamma plays an important role to trigger the macrophage act against a diverse group of microbial targets, and the pleiotropic molecule associated with antiproliferative, pro-apoptotic and antitumor mechanisms. Based on the effector cytokine considered as a major effector of immunity, it has been used in the treatment of several diseases.

Product Info Summary

SKU: PROTP01579-10
Size: 100ug,1mg
Origin Species: Human
Source: Escherichia coli
Application: Cell Culture, ELISA

Product Name

Human recombinant IFN gamma protein, GMP

View all IFN-gamma recombinant proteins

SKU/Catalog Number

PROTP01579-10

Size

100ug,1mg

Tag

His Tag (C-term)

Description

The cytokine IFN gamma could protect cells from viral infections and belongs to the family of interferons. A lot of studies have shown that IFN gamma secreted by antigen triggered cell types, including T cells, naive CD4+ T cells, macrophages, dendritic cells, and B cells. IFN gamma plays an important role to trigger the macrophage act against a diverse group of microbial targets, and the pleiotropic molecule associated with antiproliferative, pro-apoptotic and antitumor mechanisms. Based on the effector cytokine considered as a major effector of immunity, it has been used in the treatment of several diseases.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Human recombinant IFN gamma protein, GMP (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01579-10)

Form

Lyophilized

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

Purity

>95% as determined by SDS-PAGE analysis.

Predicted MW

19.348kDa

Molecular weight

The protein has a calculated MW of 17.7 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce cytotoxicity in HT29 cells. The ED₅₀ for this effect is <1 ng/mL. The specific activity of recombinant human IFN gamma is approximately >2 x 10⁶ IU/mg, which is calibrated against the human IFN Gamma WHO Reference Material (NIBSC code: 87/586).

Endotoxin

<0.05 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved.

Validation Images & Assay Conditions

Gene/Protein Information For IFNG (Source: Uniprot.org, NCBI)

Gene Name

IFNG

Full Name

Interferon gamma

Weight

19.348kDa

Superfamily

type II (or gamma) interferon family

Alternative Names

Type II interferon, T-cell interferon, MAF IFNG IFG, IFI, IMD69 interferon gamma interferon gamma|IFN-gamma|immune interferon

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IFNG, check out the IFNG Infographic

IFNG infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IFNG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP01579-10

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Human recombinant IFN gamma protein, GMP?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Human recombinant IFN gamma protein, GMP

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Human recombinant IFN gamma protein, GMP

Size

Total: $386

SKU:PROTP01579-10

Backordered.

Lead time for this item is typically 2-4 weeks

Get A Quote
In stock
Order Product
PROTP01579-10
$386.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.