Human recombinant GDNF (Glial-derived neurotrophic factor) protein, AF

GDNF protein, Human

Glial cell line-derived neurotrophic factor (GDNF) is the neurotrophic factor, belonging to the GDNF family of ligands (GFL) and identifying as a therapeutic candidate in Parkinson's disease. GDNF is a 23.7 kDa protein containing 211 residues that plays a critical role in promoting the survival and differentiation of midbrain dopamine neurons. Besides, GDNF is revealed to facilitate the development of peripheral tissues such as kidney, pancreas and lung. Additionally, as a member of GFL, GDNF also takes part in the progression of tumor.

Product Info Summary

SKU: PROTP39905-3
Size: 5ug,20ug,100ug
Origin Species: Human
Source: Escherichia coli
Application: Cell Culture

Product Name

Human recombinant GDNF (Glial-derived neurotrophic factor) protein, AF

View all GDNF recombinant proteins

SKU/Catalog Number

PROTP39905-3

Size

5ug,20ug,100ug

Tag

His Tag (C-term)

Description

Glial cell line-derived neurotrophic factor (GDNF) is the neurotrophic factor, belonging to the GDNF family of ligands (GFL) and identifying as a therapeutic candidate in Parkinson's disease. GDNF is a 23.7 kDa protein containing 211 residues that plays a critical role in promoting the survival and differentiation of midbrain dopamine neurons. Besides, GDNF is revealed to facilitate the development of peripheral tissues such as kidney, pancreas and lung. Additionally, as a member of GFL, GDNF also takes part in the progression of tumor.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Human recombinant GDNF (Glial-derived neurotrophic factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP39905-3)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.

Purity

>95% as determined by SDS-PAGE.

Predicted MW

23.72kDa

Molecular weight

The protein has a calculated MW of 16.01 kDa. The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce proliferation in SH-SY5Y cells. The ED₅₀ for this effect is <10 ng/mL.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For GDNF (Source: Uniprot.org, NCBI)

Gene Name

GDNF

Full Name

Glial cell line-derived neurotrophic factor

Weight

23.72kDa

Superfamily

TGF-beta family

Alternative Names

ATF, ATF1, ATF2, HFB1-GDNF, HSCR3 GDNF ATF, ATF1, ATF2, HFB1-GDNF, HSCR3 glial cell derived neurotrophic factor glial cell line-derived neurotrophic factor|astrocyte-derived trophic factor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GDNF, check out the GDNF Infographic

GDNF infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GDNF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP39905-3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Human recombinant GDNF (Glial-derived neurotrophic factor) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Human recombinant GDNF (Glial-derived neurotrophic factor) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Human recombinant GDNF (Glial-derived neurotrophic factor) protein, AF

Size

Total: $77

SKU:PROTP39905-3

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP39905-3
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.