Product Info Summary
SKU: | PROTP17931-4 |
---|---|
Size: | 5ug,20ug,100ug |
Origin Species: | Human |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant Galectin-3 protein, AF
View all Galectin-3 recombinant proteins
SKU/Catalog Number
PROTP17931-4
Size
5ug,20ug,100ug
Tag
His Tag (N-term)
Description
Galectin-3 (Gal-3) is one of the lectin family members, which is the only chimera?type galectin, containing one carbohydrate recognition domain (CRD) connected to a long, flexible N?terminal domain. The C?terminal CRD is responsible for β-galactoside binding, and the N?terminal domain is essential for its multimerization, and interaction with other intracellular proteins. Galectin-3 is predominantly presented in the cytoplasm and expressed on the cell surface, and then often secreted into biological fluids, such as serum and urine. Numerous studies have indicated that galectin-3 plays a crucial role in cell proliferation, apoptosis, gene expression, immune surveillance, inflammation, fibrosis, and host defense.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant Galectin-3 protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP17931-4)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
26.152kDa
Molecular weight
The protein has a calculated MW of 27 kDa. The protein migrates as 32 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measured by its ability to chemoattract human PBMC using a concentration range of 2.5-25 μg/mL. Note: Results may vary from different PBMC donors.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human Galectin-3
Protein Target Info & Infographic
Gene/Protein Information For LGALS3 (Source: Uniprot.org, NCBI)
Gene Name
LGALS3
Full Name
Galectin-3
Weight
26.152kDa
Alternative Names
IgE-binding protein, MAC2, L-29, CPB-35 LGALS3 CBP35, GAL3, GALBP, GALIG, L31, LGALS2, MAC2 galectin 3 galectin-3|35 kDa lectin|IgE-binding protein|MAC-2 |advanced glycation end-product receptor 3|carbohydrate-binding protein 35|epididymis secretory sperm binding protein|galactose-specific lectin 3|laminin-binding protein|lectin L-29|lectin, galactoside-binding, soluble, 3
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on LGALS3, check out the LGALS3 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for LGALS3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant Galectin-3 protein, AF (PROTP17931-4)
Hello CJ!
No publications found for PROTP17931-4
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant Galectin-3 protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant Galectin-3 protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question