Human recombinant Galectin-3 protein, AF

Galectin-3 protein, Human

Galectin-3 (Gal-3) is one of the lectin family members, which is the only chimera?type galectin, containing one carbohydrate recognition domain (CRD) connected to a long, flexible N?terminal domain. The C?terminal CRD is responsible for β-galactoside binding, and the N?terminal domain is essential for its multimerization, and interaction with other intracellular proteins. Galectin-3 is predominantly presented in the cytoplasm and expressed on the cell surface, and then often secreted into biological fluids, such as serum and urine. Numerous studies have indicated that galectin-3 plays a crucial role in cell proliferation, apoptosis, gene expression, immune surveillance, inflammation, fibrosis, and host defense.

Product Info Summary

SKU: PROTP17931-4
Size: 5ug,20ug,100ug
Origin Species: Human
Source: Escherichia coli
Application: Cell Culture

Product Name

Human recombinant Galectin-3 protein, AF

View all Galectin-3 recombinant proteins

SKU/Catalog Number

PROTP17931-4

Size

5ug,20ug,100ug

Tag

His Tag (N-term)

Description

Galectin-3 (Gal-3) is one of the lectin family members, which is the only chimera?type galectin, containing one carbohydrate recognition domain (CRD) connected to a long, flexible N?terminal domain. The C?terminal CRD is responsible for β-galactoside binding, and the N?terminal domain is essential for its multimerization, and interaction with other intracellular proteins. Galectin-3 is predominantly presented in the cytoplasm and expressed on the cell surface, and then often secreted into biological fluids, such as serum and urine. Numerous studies have indicated that galectin-3 plays a crucial role in cell proliferation, apoptosis, gene expression, immune surveillance, inflammation, fibrosis, and host defense.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Human recombinant Galectin-3 protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP17931-4)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>95% as determined by SDS-PAGE.

Predicted MW

26.152kDa

Molecular weight

The protein has a calculated MW of 27 kDa. The protein migrates as 32 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measured by its ability to chemoattract human PBMC using a concentration range of 2.5-25 μg/mL. Note: Results may vary from different PBMC donors.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI with polyhistidine tag at the N-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For LGALS3 (Source: Uniprot.org, NCBI)

Gene Name

LGALS3

Full Name

Galectin-3

Weight

26.152kDa

Alternative Names

IgE-binding protein, MAC2, L-29, CPB-35 LGALS3 CBP35, GAL3, GALBP, GALIG, L31, LGALS2, MAC2 galectin 3 galectin-3|35 kDa lectin|IgE-binding protein|MAC-2 |advanced glycation end-product receptor 3|carbohydrate-binding protein 35|epididymis secretory sperm binding protein|galactose-specific lectin 3|laminin-binding protein|lectin L-29|lectin, galactoside-binding, soluble, 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LGALS3, check out the LGALS3 Infographic

LGALS3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LGALS3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP17931-4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Human recombinant Galectin-3 protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Human recombinant Galectin-3 protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Human recombinant Galectin-3 protein, AF

Size

Total: $77

SKU:PROTP17931-4

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP17931-4
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product