Human recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF

CXCL9/MIG protein, Human

C-X-C motif chemokine 9 (CXCL9) also named monokine induced by gamma interferon (MIG), which is a chemokine of the intercrine alpha family. CXCL9 is a 11.4kDa protein containing 103 amino acid residues. CXCL9 controls the immune cells by binding the CXCR3 which is including the cell migration and activation. During inflammation, CXCL9 is a chemotaxis for lymphocyte and macrophages. CXCL9 is participated in the process of tumor proliferation and metastasis.

Product Info Summary

SKU: PROTQ07325-4
Size: 5ug,20ug,100ug
Origin Species: Human
Source: Escherichia coli
Application: Cell Culture

Product Name

Human recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF

View all CXCL9/MIG recombinant proteins

SKU/Catalog Number

PROTQ07325-4

Size

5ug,20ug,100ug

Tag

His Tag (N-term)

Description

C-X-C motif chemokine 9 (CXCL9) also named monokine induced by gamma interferon (MIG), which is a chemokine of the intercrine alpha family. CXCL9 is a 11.4kDa protein containing 103 amino acid residues. CXCL9 controls the immune cells by binding the CXCR3 which is including the cell migration and activation. During inflammation, CXCL9 is a chemotaxis for lymphocyte and macrophages. CXCL9 is participated in the process of tumor proliferation and metastasis.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Human recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ07325-4)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

14.019kDa

Molecular weight

The protein has a calculated MW of 12.53 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to chemoattract BaF3 cells transfected with mouse CXCR3. The ED₅₀ for this effect is <0.5 μg/mL.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT with polyhistidine tag at the N-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For CXCL9 (Source: Uniprot.org, NCBI)

Gene Name

CXCL9

Full Name

C-X-C motif chemokine 9

Weight

14.019kDa

Superfamily

intercrine alpha (chemokine CxC) family

Alternative Names

Monokine Induced by Interferon-γ, MIG CXCL9 CMK, Humig, MIG, SCYB9, crg-10 C-X-C motif chemokine ligand 9 C-X-C motif chemokine 9|chemokine (C-X-C motif) ligand 9|gamma-interferon-induced monokine|monokine induced by gamma interferon|monokine induced by interferon-gamma|small-inducible cytokine B9

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CXCL9, check out the CXCL9 Infographic

CXCL9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CXCL9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ07325-4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Human recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Human recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Human recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF

Size

Total: $77

SKU:PROTQ07325-4

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTQ07325-4
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product