Click image to see more details
Product Info Summary
| SKU: | PROTP16422-4 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant CD326 protein, AF
View all EpCAM/TROP1 recombinant proteins
SKU/Catalog Number
PROTP16422-4
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Human CD326 also called epithelial cellular adhesion molecule (EpCAM), which is a 28 kDa protein containing 242 amino acid residues. Human CD326 is a transmembrane glycoprotein, which is a marker of cancer. CD326 induces the expression of c-myc, cyclins A & E and e-fabp which is involved the cancer cell proliferation and migration.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant CD326 protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP16422-4)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
34.932kDa
Molecular weight
The protein has a calculated MW of 28.36 kDa. The protein migrates as 30 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by the ability of the immobilized protein to support the adhesion of the 3T3 cells. The ED₅₀ for this effect is 0.2-1.7 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human CD326
Protein Target Info & Infographic
Gene/Protein Information For EPCAM (Source: Uniprot.org, NCBI)
Gene Name
EPCAM
Full Name
Epithelial cell adhesion molecule
Weight
34.932kDa
Superfamily
EPCAM family
Alternative Names
EPCAM, DIAR5, EGP-2, EGP314, EGP40, ESA, HNPCC8, KS1/4, KSA, M4S1, MIC18, MK-1, TACSTD1, TROP1 EPCAM DIAR5, EGP-2, EGP314, EGP40, ESA, HNPCC8, KS1/4, KSA, M4S1, MIC18, MK-1, TACSTD1, TROP1 epithelial cell adhesion molecule epithelial cell adhesion molecule|adenocarcinoma-associated |cell surface glycoprotein Trop-1|epithelial glycoprotein 314|human epithelial glycoprotein-2|major gastrointestinal tumor-associated protein GA733-2|membrane component, chromosome 4, surface marker (35kD glycoprotein)|trophoblast cell surface 1|tumor-associated calcium signal transducer 1
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on EPCAM, check out the EPCAM Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for EPCAM: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant CD326 protein, AF (PROTP16422-4)
Hello CJ!
No publications found for PROTP16422-4
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant CD326 protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant CD326 protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
