Product Info Summary
SKU: | PROTP13236-2 |
---|---|
Size: | 5ug,20ug,100ug |
Origin Species: | Human |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant CCL4 (C-C motif chemokine ligand 4) protein, AF
View all CCL4/MIP-1 beta recombinant proteins
SKU/Catalog Number
PROTP13236-2
Size
5ug,20ug,100ug
Tag
Tag Free
Description
C-C Motif Chemokine Ligand 4 (CCL4) is a 7.66 kDa cytokine with 69 amino acid residues. CCL4, also named macrophage inflammatory protein-1β (MIP-1β), is mainly secreted from neutrophils, monocytes, B cells, T cells, fibroblasts, endothelial cells and epithelial cells. CCL4 recruits various immune cells like natural killer cells, monocytes, and neutrophils when CCL4 binds to CCR5. In addition, CCL4 mediates lymphocyte adhesion by Rac1 /Cdc42 signaling pathway and plays critical roles in different biological functions like maintenance of cell polarity, regulation of calcium ion transport and response to viruses.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant CCL4 (C-C motif chemokine ligand 4) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP13236-2)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 50 mM Tris and 150 mM NaCl, pH 8.5. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
10.212kDa
Molecular weight
The protein has a calculated MW of 7.75 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED₅₀ for this effect is <10 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
APMGSDPPTACCFSYTARKLPHNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human CCL4
Protein Target Info & Infographic
Gene/Protein Information For CCL4 (Source: Uniprot.org, NCBI)
Gene Name
CCL4
Full Name
C-C motif chemokine 4
Weight
10.212kDa
Superfamily
intercrine beta (chemokine CC) family
Alternative Names
MIP-1b: Macrophage Inflammatory Protein-1β, ACT-2 CCL4 ACT2, AT744.1, G-26, HC21, LAG-1, LAG1, MIP-1-beta, MIP1B, MIP1B1, SCYA2, SCYA4 C-C motif chemokine ligand 4 C-C motif chemokine 4|G-26 T-lymphocyte-secreted protein|MIP-1-beta(1-69)|PAT 744|SIS-gamma|T-cell activation protein 2|chemokine (C-C motif) ligand 4|lymphocyte activation gene 1 protein|macrophage inflammatory protein 1-beta|secreted protein G-26|small inducible cytokine A4 (homologous to mouse Mip-1b)
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on CCL4, check out the CCL4 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CCL4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant CCL4 (C-C motif chemokine ligand 4) protein, AF (PROTP13236-2)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant CCL4 (C-C motif chemokine ligand 4) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant CCL4 (C-C motif chemokine ligand 4) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question