Click image to see more details
Product Info Summary
| SKU: | PROTP12644-5 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant BMP-4 (Bone morphogenetic protein-4) protein, AF
View all BMP-4 recombinant proteins
SKU/Catalog Number
PROTP12644-5
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Bone Morphogenetic Protein-4 (BMP-4) is an extracellular multifunctional signaling cytokine that is also a member of the TGF-β family. BMP-4 can bind with the TGF-β receptor and trigger SMAD protein signal transduction. BMP-4 has a significant expression in the prostate, it plays a vital role in the development of mesoderm into bones and the development of the epidermis and Dorsal-Ventral axis.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant BMP-4 (Bone morphogenetic protein-4) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP12644-5)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium carbonate, pH 9.0. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
46.555kDa
Molecular weight
The protein has a calculated MW of 12.88 kDa. The protein migrates as 12 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <0.58 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human BMP-4
Protein Target Info & Infographic
Gene/Protein Information For BMP4 (Source: Uniprot.org, NCBI)
Gene Name
BMP4
Full Name
Bone morphogenetic protein 4
Weight
46.555kDa
Superfamily
TGF-beta family
Alternative Names
BMP-2B, DVR4 BMP4 BMP2B, BMP2B1, MCOPS6, OFC11, ZYME bone morphogenetic protein 4 bone morphogenetic protein 4|bone morphogenetic protein 2B
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on BMP4, check out the BMP4 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for BMP4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant BMP-4 (Bone morphogenetic protein-4) protein, AF (PROTP12644-5)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant BMP-4 (Bone morphogenetic protein-4) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant BMP-4 (Bone morphogenetic protein-4) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
