Click image to see more details
Product Info Summary
| SKU: | PROTO95390-4 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant BMP-11 (Bone morphogenetic protein-11) protein, AF
View all GDF11 recombinant proteins
SKU/Catalog Number
PROTO95390-4
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Bone Morphogenetic Protein-11 (BMP-11), known as Growth differentiation factor 11 (GDF11), is an extracellular multifunctional signaling cytokine that is also a member of the TGFβ family. BMP-11 can bind with the TGFβ receptor and is involved in SMAD protein signal transduction. Moreover, it promotes the formation of blood vessels and nerves that can control anterior-posterior patterning.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant BMP-11 (Bone morphogenetic protein-11) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95390-4)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
45.091kDa
Molecular weight
The protein has a calculated MW of 13.40 kDa. The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <11 ng/mL. Measure by its ability to induce hemoglobin expression in K562 cells. The ED₅₀ for this effect is <4 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MNLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human BMP-11
Protein Target Info & Infographic
Gene/Protein Information For GDF11 (Source: Uniprot.org, NCBI)
Gene Name
GDF11
Full Name
Growth/differentiation factor 11
Weight
45.091kDa
Superfamily
TGF-beta family
Alternative Names
Growth/Differentiation Factor-11, GDF-11 GDF11 BMP-11, BMP11, VHO growth differentiation factor 11 growth/differentiation factor 11|GDF-11|bone morphogenetic protein 11
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on GDF11, check out the GDF11 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for GDF11: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant BMP-11 (Bone morphogenetic protein-11) protein, AF (PROTO95390-4)
Hello CJ!
No publications found for PROTO95390-4
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant BMP-11 (Bone morphogenetic protein-11) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant BMP-11 (Bone morphogenetic protein-11) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
