Click image to see more details
Product Info Summary
| SKU: | PROTQ9UNG2-7 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant AITRL (Activation-induced TNFR member ligand) protein, AF
View all GITR Ligand/TNFSF18 recombinant proteins
SKU/Catalog Number
PROTQ9UNG2-7
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
AITRL also known as TNFSF18, GITRL and TL6, belonging to TNF superfamily. AITRL is a 20.3 kDa protein containing 177 residues that implicates in regulating immune systems. AITRL contributes to tumor suppression and the development of autoimmune diseases via interacting with TNFRSF18/AITR/GITR. Besides, AITRL-GITR signaling has been demonstrated to enhance phosphorylation of STAT1 and up-regulate expression of VCAM1 and ICAM1 in endothelial cells. Furthermore, AITRL can also facilitate the adhesion and transmigration of leukocytes to endothelial cells.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant AITRL (Activation-induced TNFR member ligand) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UNG2-7)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
22.724kDa
Molecular weight
The protein has a calculated MW of 15.34 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce IL-8 secretion in human PBMC using a concentration range of 5-200 ng /mL. Note: Result may vary from different PBMC donors.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGII LIANPQEI with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human AITRL
Protein Target Info & Infographic
Gene/Protein Information For TNFSF18 (Source: Uniprot.org, NCBI)
Gene Name
TNFSF18
Full Name
Tumor necrosis factor ligand superfamily member 18
Weight
22.724kDa
Superfamily
tumor necrosis factor family
Alternative Names
TL6, GITRL, TNLG2A, hGITRL, TNFSF18 TNFSF18 AITRL, GITRL, TL6, TNLG2A, hGITRL TNF superfamily member 18 tumor necrosis factor ligand superfamily member 18|AITR ligand|GITR ligand|activation-inducible TNF-related ligand|glucocorticoid-induced TNF-related ligand|glucocorticoid-induced TNFR-related protein ligand|tumor necrosis factor (ligand) superfamily, member 18|tumor necrosis factor ligand 2A|tumor necrosis factor superfamily member 18
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on TNFSF18, check out the TNFSF18 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for TNFSF18: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant AITRL (Activation-induced TNFR member ligand) protein, AF (PROTQ9UNG2-7)
Hello CJ!
No publications found for PROTQ9UNG2-7
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant AITRL (Activation-induced TNFR member ligand) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant AITRL (Activation-induced TNFR member ligand) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
