HROB (NM_024032) Human Recombinant Protein

HROB protein,

Recombinant protein of human chromosome 17 open reading frame 53 (C17orf53)

Product Info Summary

SKU: PROTQ8N3J3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HROB (NM_024032) Human Recombinant Protein

View all HROB recombinant proteins

SKU/Catalog Number

PROTQ8N3J3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 17 open reading frame 53 (C17orf53)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HROB (NM_024032) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8N3J3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

69.6 kDa

Amino Acid Sequence

MACSLQKLFAVEEEFEDEDFLSAVEDAENRFTGSLPVNAGRLRPVSSRPQETVQAQSSRLLLLHPTAPSEALGLPDLDLCLPASSTPSADSRPSCIGAAPLRPVSTSSSWIGNQRRVTVTEVLRETARPQSSALHPLLTFESQQQQVGGFEGPEQDEFDKVLASMELEEPGMELECGVSSEAIPILPAQQREGSVLAKKARVVDLSGSCQKGPVPAIHKAGIMSAQDESLDPVIQCRTPRPPLRPGAVGHLPVPTALTVPTQQLHWEVCPQRSPVQALQPLQAARGTIQSSPQNRFPCQPFQSPSSWLSGKAHLPRPRTPNSSCSTPSRTSSGLFPRIPLQPQAPVSSIGSPVGTPKGPQGALQTPIVTNHLVQLVTAASRTPQQPTHPSTRAKTRRFPGPAGILPHQQSGRSLEDIMVSAPQTPTHGALAKFQTEIVASSQASVEEDFGRGPWLTMKSTLGLDERDPSCFLCTYSIVMVLRKQAALKQLPRNKVPNMAVMIKSLTRSTMDASVVFKDPTGEMQGTVHRLLLETCQNELKPGSVLLLKQIGVFSPSLRNHYLNVTPNNLVHIYSPDSGDGSFLKPSQPFPKDSGSFQHDVAAKPEEGFRTAQNLEAEASPEEELPEADDLDGLLSELPEDFFCGTSS

Validation Images & Assay Conditions

Gene/Protein Information For C17orf53 (Source: Uniprot.org, NCBI)

Gene Name

C17orf53

Full Name

Uncharacterized protein C17orf53

Weight

69.6 kDa

Alternative Names

chromosome 17 open reading frame 53; FLJ11594; hypothetical protein LOC78995; MCM8IP; MGC3130

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on C17orf53, check out the C17orf53 Infographic

C17orf53 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for C17orf53: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8N3J3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HROB (NM_024032) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HROB (NM_024032) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HROB (NM_024032) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8N3J3
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.