HMGN3 (NM_138730) Human Recombinant Protein

HMGN3/TRIP7 protein,

Product Info Summary

SKU: PROTQ15651
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HMGN3 (NM_138730) Human Recombinant Protein

View all HMGN3/TRIP7 recombinant proteins

SKU/Catalog Number

PROTQ15651

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HMGN3 (NM_138730) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ15651)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

8.2 kDa

Amino Acid Sequence

MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTEN

Validation Images & Assay Conditions

Gene/Protein Information For HMGN3 (Source: Uniprot.org, NCBI)

Gene Name

HMGN3

Full Name

High mobility group nucleosome-binding domain-containing protein 3

Weight

8.2 kDa

Superfamily

HMGN family

Alternative Names

DKFZp686E20226; high mobility group nucleosomal binding domain 3; high mobility group nucleosome-binding domain-containing protein 3; high-mobility group protein HMGN3; PNAS-25; thyroid hormone receptor interacting protein 7; thyroid hormone receptor interactor 7; Thyroid receptor-interacting protein 7; TR-interacting protein 7; TRIP-7; TRIP7FLJ42187 HMGN3 PNAS-24, PNAS-25, TRIP7 high mobility group nucleosomal binding domain 3 high mobility group nucleosome-binding domain-containing protein 3|TR-interacting protein 7|thyroid hormone receptor interacting protein 7

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HMGN3, check out the HMGN3 Infographic

HMGN3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HMGN3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ15651

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HMGN3 (NM_138730) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HMGN3 (NM_138730) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HMGN3 (NM_138730) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ15651
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.