HMGA1 (NM_145903) Human Recombinant Protein

Hmga1 protein,

Product Info Summary

SKU: PROTP17096
Size: 20 µg
Source: HEK293T

Product Name

HMGA1 (NM_145903) Human Recombinant Protein

View all Hmga1 recombinant proteins

SKU/Catalog Number

PROTP17096

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 5

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HMGA1 (NM_145903) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP17096)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

10.5 kDa

Amino Acid Sequence

MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ

Validation Images & Assay Conditions

Gene/Protein Information For HMGA1 (Source: Uniprot.org, NCBI)

Gene Name

HMGA1

Full Name

High mobility group protein HMG-I/HMG-Y

Weight

10.5 kDa

Superfamily

HMGA family

Alternative Names

high mobility group AT-hook 1; High mobility group AT-hook protein 1; High mobility group protein A1; high mobility group protein HMG-I/HMG-Y; High mobility group protein R; high-mobility group (nonhistone chromosomal) protein isoforms I and Y; HMGA1A; HMG-I(Y); HMGIYMGC12816; HMG-R; MGC4242; MGC4854; nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y HMGA1 HMG-RA, HMGIY, HMGA1 high mobility group AT-hook 1 high mobility group protein HMG-I/HMG-Y|high mobility group protein A1|high mobility group protein R|nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HMGA1, check out the HMGA1 Infographic

HMGA1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HMGA1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP17096

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HMGA1 (NM_145903) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HMGA1 (NM_145903) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HMGA1 (NM_145903) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP17096
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.