HIST1H2AH (NM_080596) Human Recombinant Protein

Hist1h2ah protein,

Recombinant protein of human histone cluster 1, H2ah (HIST1H2AH)

Product Info Summary

SKU: PROTQ96KK5
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HIST1H2AH (NM_080596) Human Recombinant Protein

View all Hist1h2ah recombinant proteins

SKU/Catalog Number

PROTQ96KK5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human histone cluster 1, H2ah (HIST1H2AH)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HIST1H2AH (NM_080596) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96KK5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.7 kDa

Amino Acid Sequence

MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAK

Validation Images & Assay Conditions

Gene/Protein Information For HIST1H2AH (Source: Uniprot.org, NCBI)

Gene Name

HIST1H2AH

Full Name

Histone H2A type 1-H

Weight

13.7 kDa

Superfamily

histone H2A family

Alternative Names

histone cluster 1, H2ah; histone H2A type 1-H

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HIST1H2AH, check out the HIST1H2AH Infographic

HIST1H2AH infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HIST1H2AH: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96KK5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HIST1H2AH (NM_080596) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HIST1H2AH (NM_080596) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HIST1H2AH (NM_080596) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96KK5
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.