HIBADH (NM_152740) Human Recombinant Protein

HIBADH protein,

Recombinant protein of human 3-hydroxyisobutyrate dehydrogenase (HIBADH)

Product Info Summary

SKU: PROTP31937
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HIBADH (NM_152740) Human Recombinant Protein

View all HIBADH recombinant proteins

SKU/Catalog Number

PROTP31937

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human 3-hydroxyisobutyrate dehydrogenase (HIBADH)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HIBADH (NM_152740) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP31937)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

35.1 kDa

Amino Acid Sequence

MAASLRLLGAASGLRYWSRRLRPAAGSFAAVCSRSVASKTPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEETF

Validation Images & Assay Conditions

Gene/Protein Information For HIBADH (Source: Uniprot.org, NCBI)

Gene Name

HIBADH

Full Name

3-hydroxyisobutyrate dehydrogenase, mitochondrial

Weight

35.1 kDa

Superfamily

HIBADH-related family

Alternative Names

3-hydroxyisobutyrate dehydrogenase; 3-hydroxyisobutyrate dehydrogenase, mitochondrial; EC 1.1.1,3'-hydroxyisobutyrate dehydrogenase; EC 1.1.1.31; MGC40361; NS5ATP1 HIBADH NS5ATP1 3-hydroxyisobutyrate dehydrogenase 3-hydroxyisobutyrate dehydrogenase, mitochondrial|3-hydroxyisobutyrate dehydrogenase|epididymis secretory sperm binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HIBADH, check out the HIBADH Infographic

HIBADH infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HIBADH: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP31937

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HIBADH (NM_152740) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HIBADH (NM_152740) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HIBADH (NM_152740) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP31937
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.