HERPUD2 (NM_022373) Human Recombinant Protein

HERPUD2 protein,

Recombinant protein of human HERPUD family member 2 (HERPUD2)

Product Info Summary

SKU: PROTQ9BSE4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HERPUD2 (NM_022373) Human Recombinant Protein

View all HERPUD2 recombinant proteins

SKU/Catalog Number

PROTQ9BSE4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human HERPUD family member 2 (HERPUD2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HERPUD2 (NM_022373) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BSE4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

45 kDa

Amino Acid Sequence

MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLVCTSRTPPSSPKSSTNRESHEALTSSSNSSSDHSGSTTPSSGQETLSLAVGSSSEGLRQRTLPQAQTDQAQSHQFPYVMQGNVDNQFPGQAAPPGFPVYPAFSPLQMLWWQQMYAHQYYMQYQAAVSAQATSNVNPTQPTTSQPLNLAHVPGEEPPPAPNLVAQENRPMNENVQMNAQGGPVLNEEDFNRDWLDWMYTFSRAAILLSIVYFYSSFSRFIMVMGAMLLVYLHQAGWFPFRQEGGHQQAPNNNAEVNNDGQNANNLELEEMERLMDDGLEDESGEDGGEDASAIQRPGLMASAWSFITTFFTSLIPEGPPQVAN

Validation Images & Assay Conditions

Gene/Protein Information For HERPUD2 (Source: Uniprot.org, NCBI)

Gene Name

HERPUD2

Full Name

Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein

Weight

45 kDa

Alternative Names

endoplasmic reticulum stress-inducible, ubiquitin-likedomain member 2; FLJ22313; FLJ31032; HERPUD family member 2; homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domainmember 2 protein HERPUD2 HERPUD family member 2 homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein|homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HERPUD2, check out the HERPUD2 Infographic

HERPUD2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HERPUD2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BSE4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HERPUD2 (NM_022373) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HERPUD2 (NM_022373) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HERPUD2 (NM_022373) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BSE4
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.