Heat Shock Factor 2 Binding Protein (HSF2BP) (NM_007031) Human Recombinant Protein

HSF2BP protein,

Product Info Summary

SKU: PROTO75031
Size: 20 µg
Source: HEK293T

Product Name

Heat Shock Factor 2 Binding Protein (HSF2BP) (NM_007031) Human Recombinant Protein

View all HSF2BP recombinant proteins

SKU/Catalog Number

PROTO75031

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human heat shock transcription factor 2 binding protein (HSF2BP)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Heat Shock Factor 2 Binding Protein (HSF2BP) (NM_007031) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO75031)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

37.5 kDa

Amino Acid Sequence

MGEAGAAEEACRHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVEKNLERKEQELEQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQTMESFVKSLDGDVQELDSDESQFVFALAGIVTNVAAIACGREFLVNSSRVLLDTILQLLGDLKPGQCTKLKVLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQSVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV

Validation Images & Assay Conditions

Gene/Protein Information For HSF2BP (Source: Uniprot.org, NCBI)

Gene Name

HSF2BP

Full Name

Heat shock factor 2-binding protein

Weight

37.5 kDa

Alternative Names

Heat shock factor 2-binding protein HSF2BP MEILB2 heat shock transcription factor 2 binding protein heat shock factor 2-binding protein|meiotic localizer of BRCA2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HSF2BP, check out the HSF2BP Infographic

HSF2BP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HSF2BP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO75031

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Heat Shock Factor 2 Binding Protein (HSF2BP) (NM_007031) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Heat Shock Factor 2 Binding Protein (HSF2BP) (NM_007031) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Heat Shock Factor 2 Binding Protein (HSF2BP) (NM_007031) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO75031
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.