HDHD3 (NM_031219) Human Recombinant Protein

Hdhd3 protein,

Product Info Summary

SKU: PROTQ9BSH5
Size: 20 µg
Source: HEK293T

Product Name

HDHD3 (NM_031219) Human Recombinant Protein

View all Hdhd3 recombinant proteins

SKU/Catalog Number

PROTQ9BSH5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human haloacid dehalogenase-like hydrolase domain containing 3 (HDHD3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HDHD3 (NM_031219) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BSH5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.8 kDa

Amino Acid Sequence

MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGSTPGL

Validation Images & Assay Conditions

Gene/Protein Information For HDHD3 (Source: Uniprot.org, NCBI)

Gene Name

HDHD3

Full Name

Haloacid dehalogenase-like hydrolase domain-containing protein 3

Weight

27.8 kDa

Superfamily

HAD-like hydrolase superfamily

Alternative Names

C9orf158; chromosome 9 open reading frame 158,2810435D12Rik; haloacid dehalogenase-like hydrolase domain containing 3; haloacid dehalogenase-like hydrolase domain-containing protein 3; MGC12904

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HDHD3, check out the HDHD3 Infographic

HDHD3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HDHD3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BSH5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HDHD3 (NM_031219) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HDHD3 (NM_031219) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HDHD3 (NM_031219) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BSH5
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.