HDDC2 (NM_016063) Human Recombinant Protein

HDDC2 protein,

Product Info Summary

SKU: PROTQ7Z4H3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HDDC2 (NM_016063) Human Recombinant Protein

View all HDDC2 recombinant proteins

SKU/Catalog Number

PROTQ7Z4H3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human HD domain containing 2 (HDDC2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HDDC2 (NM_016063) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ7Z4H3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.2 kDa

Amino Acid Sequence

MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETRSSAEAKFVKQLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS

Validation Images & Assay Conditions

Gene/Protein Information For HDDC2 (Source: Uniprot.org, NCBI)

Gene Name

HDDC2

Full Name

HD domain-containing protein 2

Weight

23.2 kDa

Superfamily

HDDC2 family

Alternative Names

HD domain-containing protein 2 HDDC2 C6orf74, CGI-130, NS5ATP2, dJ167O5.2 HD domain containing 2 5-deoxynucleotidase HDDC2|HCV NS5A-transactivated protein 2|HD domain-containing protein 2|hepatitis C virus NS5A-transactivated protein 2|testicular tissue protein Li 83

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HDDC2, check out the HDDC2 Infographic

HDDC2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HDDC2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ7Z4H3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HDDC2 (NM_016063) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HDDC2 (NM_016063) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HDDC2 (NM_016063) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ7Z4H3
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.