HDAC3 (NM_003883) Human Recombinant Protein

HDAC3 protein,

Recombinant protein of human histone deacetylase 3 (HDAC3)

Product Info Summary

SKU: PROTO15379
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HDAC3 (NM_003883) Human Recombinant Protein

View all HDAC3 recombinant proteins

SKU/Catalog Number

PROTO15379

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human histone deacetylase 3 (HDAC3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HDAC3 (NM_003883) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO15379)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

48.7 kDa

Amino Acid Sequence

MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI

Validation Images & Assay Conditions

Gene/Protein Information For HDAC3 (Source: Uniprot.org, NCBI)

Gene Name

HDAC3

Full Name

Histone deacetylase 3

Weight

48.7 kDa

Superfamily

histone deacetylase family

Alternative Names

EC 3.5.1.98; HD3RPD3-2RPD3; HDAC3; Histone Deacetylase 3; KDAC3; RPD3-2; SMAP45 HDAC3 HD3, KDAC3, RPD3, RPD3-2 histone deacetylase 3 histone deacetylase 3|SMAP45

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HDAC3, check out the HDAC3 Infographic

HDAC3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HDAC3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO15379

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HDAC3 (NM_003883) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HDAC3 (NM_003883) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HDAC3 (NM_003883) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO15379
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.