HCST (NM_001007469) Human Recombinant Protein

DAP10/HCST protein,

Product Info Summary

SKU: PROTQ9UBK5
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HCST (NM_001007469) Human Recombinant Protein

View all DAP10/HCST recombinant proteins

SKU/Catalog Number

PROTQ9UBK5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human hematopoietic cell signal transducer (HCST), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HCST (NM_001007469) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UBK5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

7.3 kDa

Amino Acid Sequence

MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG

Validation Images & Assay Conditions

Gene/Protein Information For HCST (Source: Uniprot.org, NCBI)

Gene Name

HCST

Full Name

Hematopoietic cell signal transducer

Weight

7.3 kDa

Superfamily

DAP10 family

Alternative Names

DAP10; DAP10PIK3AP; DKFZP586C1522; HCST; hematopoietic cell signal transducer; KAP10; KAP10DNAX-activation protein 10; kinase assoc pro of ~10kDa; Kinase Assoc Protein; Membrane protein DAP10; phosphoinositide-3-kinase adaptor protein; PIK3AP; Transmembrane adapter protein KAP10 HCST DAP10, KAP10, PIK3AP hematopoietic cell signal transducer hematopoietic cell signal transducer|DNAX-activation protein 10|kinase assoc pro of ~10kDa|kinase assoc protein|membrane protein DAP10|phosphoinositide-3-kinase adaptor protein|transmembrane adapter protein KAP10

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HCST, check out the HCST Infographic

HCST infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HCST: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UBK5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HCST (NM_001007469) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HCST (NM_001007469) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HCST (NM_001007469) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UBK5
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.