HCCS (NM_001122608) Human Recombinant Protein

HCCS protein,

Recombinant protein of human holocytochrome c synthase (cytochrome c heme-lyase) (HCCS)

Product Info Summary

SKU: PROTP53701
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HCCS (NM_001122608) Human Recombinant Protein

View all HCCS recombinant proteins

SKU/Catalog Number

PROTP53701

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human holocytochrome c synthase (cytochrome c heme-lyase) (HCCS)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HCCS (NM_001122608) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP53701)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.4 kDa

Amino Acid Sequence

MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS

Validation Images & Assay Conditions

Gene/Protein Information For HCCS (Source: Uniprot.org, NCBI)

Gene Name

HCCS

Full Name

Cytochrome c-type heme lyase

Weight

30.4 kDa

Superfamily

cytochrome c-type heme lyase family

Alternative Names

CCHLDKFZp779I1858; cytochrome c heme-lyase; cytochrome c-type heme lyase; EC 4.4.1.17; holocytochrome c synthase (cytochrome c heme-lyase); holocytochrome c synthase; Holocytochrome c-type synthase; MCOPS7 HCCS CCHL, LSDMCA1, MCOPS7, MLS holocytochrome c synthase holocytochrome c-type synthase|cytochrome c heme-lyase|cytochrome c-type heme lyase|holocytochrome-c synthetase|microphthalamia with linear skin defects|microphthalmia with linear skin defects

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HCCS, check out the HCCS Infographic

HCCS infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HCCS: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP53701

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HCCS (NM_001122608) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HCCS (NM_001122608) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HCCS (NM_001122608) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP53701
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.