GSG1L (NM_144675) Human Recombinant Protein

GSG1L protein,

Recombinant protein of human GSG1-like (GSG1L), transcript variant 2

Product Info Summary

SKU: PROTQ6UXU4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

GSG1L (NM_144675) Human Recombinant Protein

View all GSG1L recombinant proteins

SKU/Catalog Number

PROTQ6UXU4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human GSG1-like (GSG1L), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GSG1L (NM_144675) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6UXU4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.4 kDa

Amino Acid Sequence

MCLELFHSSNVIDGLKLNAFAAVFTVLSGLLGMVAHMMYTQVFQVTVSLGPEDWRPHSWDYGWSFCLAWGSFTCCMAASVTTLNSYTKTVIEFRHKRKVFEQGYREEPTFIDPEAIKYFRERMEKRDGSEEDFHLDCRHERYPARHQPHMADSWPRSSAQEAPELNRQCWVLGHWV

Validation Images & Assay Conditions

Gene/Protein Information For GSG1L (Source: Uniprot.org, NCBI)

Gene Name

GSG1L

Full Name

Germ cell-specific gene 1-like protein

Weight

20.4 kDa

Superfamily

GSG1 family

Alternative Names

germ cell-specific gene 1-like protein; GSG1-like protein; GSG1-like; KTSR5831; MGC18079; PRO19651 GSG1L PRO19651 GSG1 like germ cell-specific gene 1-like protein|GSG1-like protein|KTSR5831

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GSG1L, check out the GSG1L Infographic

GSG1L infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GSG1L: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6UXU4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GSG1L (NM_144675) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GSG1L (NM_144675) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GSG1L (NM_144675) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6UXU4
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.