GNLY Granulysin Human Recombinant Protein

Granulysin protein, Human

GNLY Human Recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus) and having a total molecular mass of 18.1 kDa. The GNLY is purified by proprietary chromatographic techniques.

Product Info Summary

SKU: PROTP22749
Size: 2ug, 10ug, 1mg
Origin Species: Human
Source: Escherichia coli

Product Name

GNLY Granulysin Human Recombinant Protein

View all Granulysin recombinant proteins

SKU/Catalog Number

PROTP22749

Size

2ug, 10ug, 1mg

Description

GNLY Human Recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus) and having a total molecular mass of 18.1 kDa. The GNLY is purified by proprietary chromatographic techniques.

Storage & Handling

Lyophilized Granulysin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Granulysin should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Cite This Product

GNLY Granulysin Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP22749)

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

The Granulysin protein was lyophilized from a concentrated (1mg/ml) solution containing no additives.

Purity

Greater than 95.0% as determined by SDS-PAGE.

Predicted MW

16.374kDa

Reconstitution

It is recommended to reconstitute the lyophilized Granulysin in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Amino Acid Sequence

SSGLVPRGSHMMEGLVFSRLSPEYYD LARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYR TCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWR DVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPS TGPLGS

Reconstitution

It is recommended to reconstitute the lyophilized Granulysin in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Validation Images & Assay Conditions

Gene/Protein Information For GNLY (Source: Uniprot.org, NCBI)

Gene Name

GNLY

Full Name

Granulysin

Weight

16.374kDa

Alternative Names

LAG2; Lymphokine LAG-2; TLA519; NKG5; LAG2; D2S69E; Granulysin; T-cell activation protein 519; GNLY; D2S69E GNLY D2S69E, LAG-2, LAG2, NKG5, TLA519 granulysin granulysin|T-cell activation protein 519|T-lymphocyte activation gene 519|lymphocyte-activation gene 2|lymphokine LAG-2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GNLY, check out the GNLY Infographic

GNLY infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GNLY: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP22749

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GNLY Granulysin Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GNLY Granulysin Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GNLY Granulysin Human Recombinant Protein

Size

Total: $250

SKU:PROTP22749

Backordered.

Lead time for this item is typically 10-14 days

Get A Quote
In stock
Order Product
PROTP22749
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.