Glutathione S Transferase theta 2 (GSTT2) (NM_000854) Human Recombinant Protein

GSTT2 protein,

Product Info Summary

SKU: PROTP0CG29
Size: 20 µg
Source: HEK293T

Product Name

Glutathione S Transferase theta 2 (GSTT2) (NM_000854) Human Recombinant Protein

View all GSTT2 recombinant proteins

SKU/Catalog Number

PROTP0CG29

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human glutathione S-transferase theta 2 (GSTT2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Glutathione S Transferase theta 2 (GSTT2) (NM_000854) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP0CG29)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.3 kDa

Amino Acid Sequence

MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP

Validation Images & Assay Conditions

Gene/Protein Information For GSTT2 (Source: Uniprot.org, NCBI)

Gene Name

GSTT2

Full Name

Glutathione S-transferase theta-2

Weight

27.3 kDa

Superfamily

GST superfamily

Alternative Names

EC 2.5.1.18; glutathione S-transferase theta 2; glutathione S-transferase theta-2; GST class-theta-2; MGC182032 GSTT2 glutathione S-transferase theta 2 (gene/pseudogene) glutathione S-transferase theta-2|GST class-theta-2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GSTT2, check out the GSTT2 Infographic

GSTT2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GSTT2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP0CG29

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Glutathione S Transferase theta 2 (GSTT2) (NM_000854) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Glutathione S Transferase theta 2 (GSTT2) (NM_000854) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Glutathione S Transferase theta 2 (GSTT2) (NM_000854) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP0CG29
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.