Glutathione Peroxidase 7 (GPX7) (NM_015696) Human Recombinant Protein

Glutathione Peroxidase 7 protein,

Product Info Summary

SKU: PROTQ96SL4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Glutathione Peroxidase 7 (GPX7) (NM_015696) Human Recombinant Protein

View all Glutathione Peroxidase 7 recombinant proteins

SKU/Catalog Number

PROTQ96SL4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human glutathione peroxidase 7 (GPX7)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Glutathione Peroxidase 7 (GPX7) (NM_015696) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96SL4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.8 kDa

Amino Acid Sequence

MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL

Validation Images & Assay Conditions

Gene/Protein Information For GPX7 (Source: Uniprot.org, NCBI)

Gene Name

GPX7

Full Name

Glutathione peroxidase 7

Weight

20.8 kDa

Superfamily

glutathione peroxidase family

Alternative Names

CL683; EC 1.11.1; FLJ14777; glutathione peroxidase 6; glutathione peroxidase 7; GPX6EC 1.11.1.9; GPx-7; GSHPx-7; non-selenocysteine containing phospholipid hydroperoxide glutathione peroxidase; NPGPx GPX7 CL683, GPX6, GPx-7, GSHPx-7, NPGPx glutathione peroxidase 7 glutathione peroxidase 7|glutathione peroxidase 6|non-selenocysteine containing phospholipid hydroperoxide glutathione peroxidase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GPX7, check out the GPX7 Infographic

GPX7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GPX7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96SL4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Glutathione Peroxidase 7 (GPX7) (NM_015696) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Glutathione Peroxidase 7 (GPX7) (NM_015696) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Glutathione Peroxidase 7 (GPX7) (NM_015696) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96SL4
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product