GFUS (NM_003313) Human Recombinant Protein

TSTA3 protein,

Product Info Summary

SKU: PROTQ13630
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

GFUS (NM_003313) Human Recombinant Protein

View all TSTA3 recombinant proteins

SKU/Catalog Number

PROTQ13630

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tissue specific transplantation antigen P35B (TSTA3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GFUS (NM_003313) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13630)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

35.7 kDa

Amino Acid Sequence

MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK

Validation Images & Assay Conditions

Gene/Protein Information For TSTA3 (Source: Uniprot.org, NCBI)

Gene Name

TSTA3

Full Name

GDP-L-fucose synthase

Weight

35.7 kDa

Superfamily

NAD(P)-dependent epimerase/dehydratase family

Alternative Names

EC 1.1.1.271; FX; GDP-4-keto-6-deoxy-D-mannose epimerase-reductase; GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase; GDP-L-fucose synthase; P35B; Protein FX; Red cell NADP(H)-binding protein; SDR4E13-5 epimerase/4-reductase; short chain dehydrogenase/reductase family 4E, member 1; Short-chain dehydrogenase/reductase family 4E member 1; tissue specific transplantation antigen 3; tissue specific transplantation antigen P35B; Tissue-specific transplantation antigen-3 GFUS FX, P35B, SDR4E1, TSTA3 GDP-L-fucose synthase GDP-L-fucose synthase|3-5 epimerase/4-reductase|GDP-4-keto-6-deoxy-D-mannose epimerase-reductase|GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase|red cell NADP(H)-binding protein|short chain dehydrogenase/reductase family 4E, member 1|testis tissue sperm-binding protein Li 45a|tissue specific transplantation 3|tissue specific transplantation P35B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TSTA3, check out the TSTA3 Infographic

TSTA3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TSTA3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13630

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GFUS (NM_003313) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GFUS (NM_003313) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GFUS (NM_003313) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13630
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.