Gemin 2 (GEMIN2) (NM_003616) Human Recombinant Protein

GEMIN2 protein,

Recombinant protein of human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha

Product Info Summary

SKU: PROTO14893
Size: 20 µg
Source: HEK293T

Product Name

Gemin 2 (GEMIN2) (NM_003616) Human Recombinant Protein

View all GEMIN2 recombinant proteins

SKU/Catalog Number

PROTO14893

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Gemin 2 (GEMIN2) (NM_003616) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO14893)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

31.4 kDa

Amino Acid Sequence

MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS

Validation Images & Assay Conditions

Gene/Protein Information For GEMIN2 (Source: Uniprot.org, NCBI)

Gene Name

GEMIN2

Full Name

Gem-associated protein 2

Weight

31.4 kDa

Superfamily

gemin-2 family

Alternative Names

Component of gems 2; Gemin-2; GEMIN2survival of motor neuron protein-interacting protein 1; SIP1-delta; SMN interacting protein 1-delta; SMN-interacting protein 1; survival of motor neuron protein interacting protein 1 GEMIN2 SIP1, SIP1-delta gem nuclear organelle associated protein 2 gem-associated protein 2|SMN interacting protein 1-delta|component of gems 2|gemin-2|survival of motor neuron protein interacting protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GEMIN2, check out the GEMIN2 Infographic

GEMIN2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GEMIN2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO14893

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Gemin 2 (GEMIN2) (NM_003616) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Gemin 2 (GEMIN2) (NM_003616) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Gemin 2 (GEMIN2) (NM_003616) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO14893
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.