GCDFP 15 (PIP) (NM_002652) Human Recombinant Protein

PIP protein,

Product Info Summary

SKU: PROTP12273
Size: 20 µg
Source: HEK293T

Product Name

GCDFP 15 (PIP) (NM_002652) Human Recombinant Protein

View all PIP recombinant proteins

SKU/Catalog Number

PROTP12273

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human prolactin-induced protein (PIP)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GCDFP 15 (PIP) (NM_002652) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP12273)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.4 kDa

Amino Acid Sequence

MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE

Validation Images & Assay Conditions

Gene/Protein Information For PIP (Source: Uniprot.org, NCBI)

Gene Name

PIP

Full Name

Prolactin-inducible protein

Weight

16.4 kDa

Superfamily

PIP family

Alternative Names

GCDFP15prolactin-inducible protein; GCDFP-15SABP; GPIP4gp17; Gross cystic disease fluid protein 15; prolactin-induced proteinSecretory actin-binding protein PIP GCDFP-15, GCDFP15, GPIP4 prolactin induced protein prolactin-inducible protein|SABP|gross cystic disease fluid protein 15|secretory actin-binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PIP, check out the PIP Infographic

PIP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PIP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP12273

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GCDFP 15 (PIP) (NM_002652) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GCDFP 15 (PIP) (NM_002652) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GCDFP 15 (PIP) (NM_002652) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP12273
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.