FVT1 (KDSR) (NM_002035) Human Recombinant Protein

FVT1 protein,

Product Info Summary

SKU: PROTQ06136
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FVT1 (KDSR) (NM_002035) Human Recombinant Protein

View all FVT1 recombinant proteins

SKU/Catalog Number

PROTQ06136

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human 3-ketodihydrosphingosine reductase (KDSR)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FVT1 (KDSR) (NM_002035) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ06136)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33.4 kDa

Amino Acid Sequence

MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMMQREKSENADKTA

Validation Images & Assay Conditions

Gene/Protein Information For KDSR (Source: Uniprot.org, NCBI)

Gene Name

KDSR

Full Name

3-ketodihydrosphingosine reductase

Weight

33.4 kDa

Superfamily

short-chain dehydrogenases/reductases (SDR) family

Alternative Names

3-ketodihydrosphingosine reductase; DHSR; EC 1.1.1.102,3-dehydrosphinganine reductase; FLJ36555; FLJ92680; follicular lymphoma variant translocation 1; Follicular variant translocation protein 1; FVT-1; FVT1KDS reductase; SDR35C1; short chain dehydrogenase/reductase family 35C, member 1 KDSR DHSR, EKVP4, FVT1, SDR35C1 3-ketodihydrosphingosine reductase 3-ketodihydrosphingosine reductase|3-dehydrosphinganine reductase|FVT-1|KDS reductase|follicular lymphoma variant translocation 1|follicular variant translocation protein 1|short chain dehydrogenase/reductase family 35C member 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on KDSR, check out the KDSR Infographic

KDSR infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KDSR: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ06136

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FVT1 (KDSR) (NM_002035) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FVT1 (KDSR) (NM_002035) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FVT1 (KDSR) (NM_002035) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ06136
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.