Flt3 ligand (FLT3LG) (NM_001459) Human Recombinant Protein

Flt-3 Ligand/FLT3L protein,

Product Info Summary

SKU: PROTP49771
Size: 20 µg
Source: HEK293T

Product Name

Flt3 ligand (FLT3LG) (NM_001459) Human Recombinant Protein

View all Flt-3 Ligand/FLT3L recombinant proteins

SKU/Catalog Number

PROTP49771

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human fms-related tyrosine kinase 3 ligand (FLT3LG)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Flt3 ligand (FLT3LG) (NM_001459) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP49771)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

26.2 kDa

Amino Acid Sequence

MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH

Validation Images & Assay Conditions

Gene/Protein Information For FLT3LG (Source: Uniprot.org, NCBI)

Gene Name

FLT3LG

Full Name

Fms-related tyrosine kinase 3 ligand

Weight

26.2 kDa

Alternative Names

FL; FLG3L; Flt3 ligand; Flt-3 Ligand; Flt3L; FLT3LG; fms-related tyrosine kinase 3 ligand; SL cytokine FLT3LG FL, FLG3L, FLT3L fms related receptor tyrosine kinase 3 ligand fms-related tyrosine kinase 3 ligand|flt3 ligand|fms related tyrosine kinase 3 ligand

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FLT3LG, check out the FLT3LG Infographic

FLT3LG infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FLT3LG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP49771

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Flt3 ligand (FLT3LG) (NM_001459) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Flt3 ligand (FLT3LG) (NM_001459) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Flt3 ligand (FLT3LG) (NM_001459) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP49771
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.